Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7957
Gene name Gene Name - the full gene name approved by the HGNC.
EPM2A glucan phosphatase, laforin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EPM2A
Synonyms (NCBI Gene) Gene synonyms aliases
EPM2, MELF, MELF2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MELF2
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a dual-specificity phosphatase and may be involved in the regulation of glycogen metabolism. The protein acts on complex carbohydrates to prevent glycogen hyperphosphorylation, thus avoiding the formation of insoluble aggregates. Loss-of
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104893950 G>A,C Pathogenic Intron variant, non coding transcript variant, coding sequence variant, genic downstream transcript variant, missense variant, stop gained
rs137852915 G>A Pathogenic Non coding transcript variant, 5 prime UTR variant, genic upstream transcript variant, missense variant, coding sequence variant
rs137852916 C>T Pathogenic, uncertain-significance Missense variant, intron variant, coding sequence variant
rs137852917 C>A,T Likely-pathogenic, pathogenic Non coding transcript variant, intron variant, genic downstream transcript variant, missense variant, coding sequence variant
rs146321088 C>T Uncertain-significance, conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, coding sequence variant, synonymous variant, intron variant, missense variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024904 hsa-miR-215-5p Microarray 19074876
MIRT026512 hsa-miR-192-5p Microarray 19074876
MIRT030853 hsa-miR-21-5p Microarray 18591254
MIRT966833 hsa-miR-127-5p CLIP-seq
MIRT966834 hsa-miR-1287 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24837458
GO:0005634 Component Nucleus IEA
GO:0016239 Process Positive regulation of macroautophagy IMP 20453062
GO:0032007 Process Negative regulation of TOR signaling IMP 20453062
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607566 3413 ENSG00000112425
Protein
UniProt ID O95278
Protein name Laforin (EC 3.1.3.-) (EC 3.1.3.16) (EC 3.1.3.48) (Glucan phosphatase) (Glycogen phosphatase) (Lafora PTPase) (LAFPTPase)
Protein function Plays an important role in preventing glycogen hyperphosphorylation and the formation of insoluble aggregates, via its activity as glycogen phosphatase, and by promoting the ubiquitination of proteins involved in glycogen metabolism via its inte
PDB 4R30 , 4RKK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00686 CBM_20 9 117 Starch binding domain Family
PF00782 DSPc 164 311 Dual specificity phosphatase, catalytic domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, skeletal muscle, kidney, pancreas and brain. Isoform 4 is also expressed in the placenta. {ECO:0000269|PubMed:14532330, ECO:0000269|PubMed:9771710}.
Sequence
Sequence length 331
UniProt ID B3EWF7
Protein name Laforin, isoform 9
Family and domains
Sequence
MHPKEGAEQHVFSPVPGAPTPPPNRCGRLVLGPRLPAAGTPGPGIRAAAARHALPLWGGG
ATRRGRRPAGAAGGGVAARAGALGAARCRPPEAGRHRGGRRGPGPAGAGPVARGGGAGGR
GGGAGRGGAGPRGHVLVQVPEAGAGRRALLGRYCQQTPAPGAERELRPAPPTGASASGRP
RRPRRRASRAFCPRPCALPGRPGLTLLCRPRCRRQPRLRLPTDSLDPYSAPGRLPAHSVA
CPSDLVSAHPVLSFFPTAPASRASALRLPPGAPFALRVPLDLRVPPFAGPLAARPRAADG
FNSPTPPWLGFVSSFSCSNSLKKTQNDPTNETSVFANPRQQCAT
Sequence length 344
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Glycogen synthesis
Myoclonic epilepsy of Lafora
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Action myoclonus-renal failure syndrome Action Myoclonus-Renal Failure Syndrome rs727502772, rs727502773, rs121909118, rs121909119, rs727502781, rs727502782, rs200053119, rs886041078, rs886041077, rs886041076, rs886041075, rs995674389, rs1553948516, rs1578733075 25401298
Apraxia Apraxias rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672
Dentatorubral pallidoluysian atrophy Dentatorubral-Pallidoluysian Atrophy rs60216939 25401298
Epilepsy Epilepsy, Rolandic rs113994140, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs387906420, rs121917752, rs121918622, rs281865564, rs387907313, rs397514670
View all (165 more)
29358611
Unknown
Disease term Disease name Evidence References Source
Absence seizure Atypical absence seizure ClinVar
Mental depression Depressive disorder ClinVar
Ovarian cancer Ovarian cancer Conditional KD of IL6 in the OCCA xenograft model delays tumor growth GWAS, CBGDA
Dementia Dementia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Dermatitis Exfoliative Associate 25950944
Diabetes Mellitus Associate 34329319
Diabetes Mellitus Type 2 Associate 34329319
Epilepsies Myoclonic Associate 20152902, 25538239
Epilepsy Associate 27514803
Lafora Disease Associate 12960212, 15930137, 16650146, 16950819, 17452581, 17509003, 20152902, 20738377, 21728993, 21738631, 21887368, 22961547, 25538239, 25544560, 26546463
View all (9 more)
Liver Diseases Associate 17452581
Mental Disorders Associate 25950944