Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	79444
Gene name	Baculoviral IAP repeat containing 7
Gene symbol	BIRC7
Synonyms (NCBI Gene)	KIAPLIVINML-IAPMLIAPRNF50
Chromosome	20
Chromosome location	20q13.33
Summary	This gene encodes a member of the inhibitor of apoptosis protein (IAP) family, and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with c

Show/Hide all (17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438448	hsa-miR-198	Luciferase reporter assayqRT-PCRWestern blot	23069480
MIRT438448	hsa-miR-198	Luciferase reporter assayqRT-PCRWestern blot	23069480
MIRT821691	hsa-miR-1207-5p	CLIP-seq
MIRT821692	hsa-miR-3184	CLIP-seq
MIRT821693	hsa-miR-423-5p	CLIP-seq
MIRT821694	hsa-miR-4270	CLIP-seq
MIRT821695	hsa-miR-4441	CLIP-seq
MIRT821696	hsa-miR-4514	CLIP-seq
MIRT821697	hsa-miR-4688	CLIP-seq
MIRT821698	hsa-miR-4692	CLIP-seq
MIRT821699	hsa-miR-4763-3p	CLIP-seq
MIRT821700	hsa-miR-4773	CLIP-seq
MIRT821701	hsa-miR-486-3p	CLIP-seq
MIRT821696	hsa-miR-4514	CLIP-seq
MIRT821702	hsa-miR-455-3p	CLIP-seq
MIRT821698	hsa-miR-4692	CLIP-seq
MIRT821700	hsa-miR-4773	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MITF	Unknown	18451137

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002088	Process	Lens development in camera-type eye	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	16729033
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	TAS	21617971
GO:0005515	Function	Protein binding	IPI	11024045, 11084335, 11801603, 11865055, 16729033, 25416956, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17294084
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17294084
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	17294084
GO:0005794	Component	Golgi apparatus	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	11865055
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0016567	Process	Protein ubiquitination	IDA	16729033
GO:0016740	Function	Transferase activity	IEA
GO:0019899	Function	Enzyme binding	NAS	11801603
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IBA
GO:0042127	Process	Regulation of cell population proliferation	IDA	21617971
GO:0042981	Process	Regulation of apoptotic process	IDA	11865055
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	16729033
GO:0043066	Process	Negative regulation of apoptotic process	NAS	11162435
GO:0046330	Process	Positive regulation of JNK cascade	IDA	11865055
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070247	Process	Regulation of natural killer cell apoptotic process	IDA	18034418

MIM	HGNC	e!Ensembl
605737	13702	ENSG00000101197

Q96CA5

Protein name

Baculoviral IAP repeat-containing protein 7 (EC 2.3.2.27) (Kidney inhibitor of apoptosis protein) (KIAP) (Livin) (Melanoma inhibitor of apoptosis protein) (ML-IAP) (RING finger protein 50) (RING-type E3 ubiquitin transferase BIRC7) [Cleaved into: Baculovi

Protein function

Apoptotic regulator capable of exerting proapoptotic and anti-apoptotic activities and plays crucial roles in apoptosis, cell proliferation, and cell cycle control (PubMed:11024045, PubMed:11084335, PubMed:11162435, PubMed:16729033, PubMed:17294

PDB

1OXN , 1OXQ , 1OY7 , 1TW6 , 2I3H , 2I3I , 3F7G , 3F7H , 3F7I , 3GT9 , 3GTA , 3UW5 , 4AUQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00653	BIR	90 → 155	Inhibitor of Apoptosis domain	Domain
PF13920	zf-C3HC4_3	248 → 292		Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed at very low levels or not detectable in most adult tissues. Detected in adult heart, placenta, lung, lymph node, spleen and ovary, and in several carcinoma cell lines. Isoform 2 is detected in feta

Sequence

MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVE
AQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

Sequence length

298

Interactions

View interactions

	KEGG
	Ubiquitin mediated proteolysis Apoptosis - multiple species Toxoplasmosis Pathways in cancer Small cell lung cancer

BIRC7 (baculoviral IAP repeat containing 7)