LST1 (leukocyte specific transcript 1)

Gene

• Entrez ID: 7940
• Gene name: Leukocyte specific transcript 1
• Gene symbol: LST1
• Synonyms (NCBI Gene): B144, D6S49E, LST-1
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: The protein encoded by this gene is a membrane protein that can inhibit the proliferation of lymphocytes. Expression of this gene is enhanced by lipopolysaccharide, interferon-gamma, and bacteria. Several transcript variants encoding different isoforms ha

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005737	Component	Cytoplasm	IDA	11478849
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	NAS	11478849
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	7590964, 10944527
GO:0008360	Process	Regulation of cell shape	IEA
GO:0009653	Process	Anatomical structure morphogenesis	NAS	10944527
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	10706707
GO:0016020	Component	Membrane	IEA
GO:0016358	Process	Dendrite development	IBA
GO:0016358	Process	Dendrite development	IDA	11478849
GO:0050672	Process	Negative regulation of lymphocyte proliferation	IDA	10706707

Other IDs

• MIM: 109170
• HGNC: 14189
• e!Ensembl: ENSG00000204482

Protein

• UniProt ID: O00453
• Protein name: Leukocyte-specific transcript 1 protein (Protein B144)
• Protein function: Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05083	LST1	16 → 96	LST-1 protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain. {ECO:0000269|PubMed:7590964, ECO:0000269|PubMed:9367684}.
• Sequence:

  MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQ
  RLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

• Sequence length: 97