Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7936
Gene name Gene Name - the full gene name approved by the HGNC.	Negative elongation factor complex member E
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NELFE
Synonyms (NCBI Gene) Gene synonyms aliases	D6S45, NELF-E, RD, RDBP, RDP
Disease Acronyms (UniProt) Disease acronyms from UniProt database	RD
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated th

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029251	hsa-miR-26b-5p	Microarray	19088304
MIRT037783	hsa-miR-628-5p	CLASH	23622248
MIRT037249	hsa-miR-877-5p	CLASH	23622248
MIRT528207	hsa-miR-501-5p	PAR-CLIP	22012620
MIRT528206	hsa-miR-488-5p	PAR-CLIP	22012620
MIRT528205	hsa-miR-1273c	PAR-CLIP	22012620
MIRT528204	hsa-miR-3683	PAR-CLIP	22012620
MIRT528203	hsa-miR-124-5p	PAR-CLIP	22012620
MIRT528202	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT528201	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT528200	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT528207	hsa-miR-501-5p	PAR-CLIP	22012620
MIRT528206	hsa-miR-488-5p	PAR-CLIP	22012620
MIRT528205	hsa-miR-1273c	PAR-CLIP	22012620
MIRT528204	hsa-miR-3683	PAR-CLIP	22012620
MIRT528203	hsa-miR-124-5p	PAR-CLIP	22012620
MIRT528202	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT528201	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT528200	hsa-miR-3180-5p	PAR-CLIP	22012620

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	NAS	2119325
GO:0005515	Function	Protein binding	IPI	12612062, 14667819, 24981860, 25416956, 26496610, 28514442, 32296183
GO:0005634	Component	Nucleus	NAS	2119325
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006366	Process	Transcription by RNA polymerase II	TAS
GO:0006368	Process	Transcription elongation from RNA polymerase II promoter	TAS
GO:0016604	Component	Nuclear body	IDA
GO:0032021	Component	NELF complex	IBA	21873635
GO:0032021	Component	NELF complex	IDA	12612062
GO:0034244	Process	Negative regulation of transcription elongation from RNA polymerase II promoter	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050434	Process	Positive regulation of viral transcription	TAS
GO:0051571	Process	Positive regulation of histone H3-K4 methylation	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:1900364	Process	Negative regulation of mRNA polyadenylation	IMP	19575011

MIM	HGNC	e!Ensembl
154040	13974	ENSG00000204356

Protein

UniProt ID

P18615

Protein name

Negative elongation factor E (NELF-E) (RNA-binding protein RD)

Protein function

Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II (PubMed:10199401, PubMed:27256882). The NELF complex, which acts via an association with the DSIF complex and cause

PDB

1X5P , 2BZ2 , 2JX2 , 5OOB , 6GML , 7YCX , 8JJ6 , 8UHA , 8UHD , 8UHG , 8UI0 , 8W8E , 9J0N , 9J0O , 9J0P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	267 → 326	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in heart, brain, lung, placenta, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:12612062}.

Sequence

MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLSEQPVMDTAT
ATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDL
QESSRRPQRKSLYESFVSSSDRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHSSA
SPPRSRSRDRSHERNRDRDRDRERDRDRDRDRDRERDRDRDRDRDRDRERDRDRERDRDR
DREGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFV
TYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRD
KRTQIVYSDDVYKENLVDGF

Sequence length

380

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1		Formation of RNA Pol II elongation complex Formation of the Early Elongation Complex Formation of HIV-1 elongation complex containing HIV-1 Tat RNA Polymerase II Pre-transcription Events TP53 Regulates Transcription of DNA Repair Genes RNA Polymerase II Transcription Elongation

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Age-related macular degeneration	Age related macular degeneration	rs199474657, rs61750120, rs1800728, rs62654397, rs61749423, rs61751412, rs61749439, rs61751398, rs61752417, rs62645946, rs1801269, rs62646860, rs61750142, rs61750145, rs61750152 View all (20 more)	23577725
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	20598377
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	21156761

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	37117180
Carcinoma Hepatocellular	Associate	12079511, 30833661, 34288818
Kidney Neoplasms	Associate	37047552
Leukemia Lymphocytic Chronic B Cell	Associate	12079511
Lymphoma Non Hodgkin	Associate	31026237
Macular Degeneration	Associate	23577725
Necrosis	Associate	25765771
Neoplasms	Inhibit	25765771
Neoplasms	Associate	30833661, 31638184
Pancreatic Neoplasms	Associate	31638184

NELFE (negative elongation factor complex member E)