NELFE (negative elongation factor complex member E)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7936
Gene name Gene Name - the full gene name approved by the HGNC.
Negative elongation factor complex member E
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NELFE
Synonyms (NCBI Gene) Gene synonyms aliases
D6S45, NELF-E, RD, RDBP, RDP
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated th
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(19)
miRTarBase ID miRNA Experiments Reference
MIRT029251 hsa-miR-26b-5p Microarray 19088304
MIRT037783 hsa-miR-628-5p CLASH 23622248
MIRT037249 hsa-miR-877-5p CLASH 23622248
MIRT528207 hsa-miR-501-5p PAR-CLIP 22012620
MIRT528206 hsa-miR-488-5p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(33)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin IDA 14701750, 27256882
GO:0000785 Component Chromatin IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003682 Function Chromatin binding IDA 14701750, 27256882
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
154040 13974 ENSG00000204356
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID P18615
Protein name Negative elongation factor E (NELF-E) (RNA-binding protein RD)
Protein function Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II (PubMed:10199401, PubMed:27256882). The NELF complex, which acts via an association with the DSIF complex and cause
PDB 1X5P , 2BZ2 , 2JX2 , 5OOB , 6GML , 7YCX , 8JJ6 , 8UHA , 8UHD , 8UHG , 8UI0 , 8W8E , 9J0N , 9J0O , 9J0P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 267 → 326 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in heart, brain, lung, placenta, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:12612062}.
Sequence 
MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLSEQPVMDTAT
ATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDL
QESSRRPQRKSLYESFVSSSDRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHSSA
SPPRSRSRDRSHERNRDRDRDRERDRDRDRDRDRERDRDRDRDRDRDRERDRDRERDRDR
DREGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFV
TYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRD
KRTQIVYSDDVYKENLVDGF
Sequence length 380
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG   Reactome
  Viral life cycle - HIV-1   Formation of RNA Pol II elongation complex
Formation of the Early Elongation Complex
Formation of HIV-1 elongation complex containing HIV-1 Tat
RNA Polymerase II Pre-transcription Events
TP53 Regulates Transcription of DNA Repair Genes
RNA Polymerase II Transcription Elongation
<