NELFE (negative elongation factor complex member E)

Gene

• Entrez ID: 7936
• Gene name: Negative elongation factor complex member E
• Gene symbol: NELFE
• Synonyms (NCBI Gene): D6S45, NELF-E, RD, RDBP, RDP
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029251	hsa-miR-26b-5p	Microarray	19088304
MIRT037783	hsa-miR-628-5p	CLASH	23622248
MIRT037249	hsa-miR-877-5p	CLASH	23622248
MIRT528207	hsa-miR-501-5p	PAR-CLIP	22012620
MIRT528206	hsa-miR-488-5p	PAR-CLIP	22012620
MIRT528205	hsa-miR-1273c	PAR-CLIP	22012620
MIRT528204	hsa-miR-3683	PAR-CLIP	22012620
MIRT528203	hsa-miR-124-5p	PAR-CLIP	22012620
MIRT528202	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT528201	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT528200	hsa-miR-3180-5p	PAR-CLIP	22012620
MIRT528207	hsa-miR-501-5p	PAR-CLIP	22012620
MIRT528206	hsa-miR-488-5p	PAR-CLIP	22012620
MIRT528205	hsa-miR-1273c	PAR-CLIP	22012620
MIRT528204	hsa-miR-3683	PAR-CLIP	22012620
MIRT528203	hsa-miR-124-5p	PAR-CLIP	22012620
MIRT528202	hsa-miR-520a-5p	PAR-CLIP	22012620
MIRT528201	hsa-miR-525-5p	PAR-CLIP	22012620
MIRT528200	hsa-miR-3180-5p	PAR-CLIP	22012620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	14701750, 27256882
GO:0000785	Component	Chromatin	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003682	Function	Chromatin binding	IDA	14701750, 27256882
GO:0003682	Function	Chromatin binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IDA	27256882
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	NAS	2119325
GO:0003729	Function	MRNA binding	IDA	27256882
GO:0005515	Function	Protein binding	IPI	12612062, 14667819, 20211142, 24981860, 25416956, 26496610, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	27256882
GO:0005634	Component	Nucleus	IDA	12612062
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	2119325
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	29849146
GO:0016604	Component	Nuclear body	IDA
GO:0032021	Component	NELF complex	IBA
GO:0032021	Component	NELF complex	IDA	12612062
GO:0032021	Component	NELF complex	IEA
GO:0032021	Component	NELF complex	IPI	12612062
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IBA
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IDA	12612062, 27256882
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0160239	Process	Transcription pausing by RNA polymerase II	IDA	14701750, 27256882

Other IDs

• MIM: 154040
• HGNC: 13974
• e!Ensembl: ENSG00000204356

Protein

• UniProt ID: P18615
• Protein name: Negative elongation factor E (NELF-E) (RNA-binding protein RD)
• Protein function: Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II (PubMed:10199401, PubMed:27256882). The NELF complex, which acts via an association with the DSIF complex and cause
• PDB: 1X5P, 2BZ2, 2JX2, 5OOB, 6GML, 7YCX, 8JJ6, 8UHA, 8UHD, 8UHG, 8UI0, 8W8E, 9J0N, 9J0O, 9J0P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	267 → 326	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed in heart, brain, lung, placenta, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:12612062}.
• Sequence:

  MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLSEQPVMDTAT
  ATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDL
  QESSRRPQRKSLYESFVSSSDRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHSSA
  SPPRSRSRDRSHERNRDRDRDRERDRDRDRDRDRERDRDRDRDRDRDRERDRDRERDRDR
  DREGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFV
  TYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRD
  KRTQIVYSDDVYKENLVDGF

• Sequence length: 380

Pathways

KEGG:

Viral life cycle - HIV-1

Reactome:

Formation of RNA Pol II elongation complex
Formation of the Early Elongation Complex
Formation of HIV-1 elongation complex containing HIV-1 Tat
RNA Polymerase II Pre-transcription Events
TP53 Regulates Transcription of DNA Repair Genes
RNA Polymerase II Transcription Elongation