Gene Gene information from NCBI Gene database.
Entrez ID 793
Gene name Calbindin 1
Gene symbol CALB1
Synonyms (NCBI Gene)
CALBD-28K
Chromosome 8
Chromosome location 8q21.3
Summary The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding doma
miRNA miRNA information provided by mirtarbase database.
40
miRTarBase ID miRNA Experiments Reference
MIRT858716 hsa-miR-1302 CLIP-seq
MIRT858717 hsa-miR-181a CLIP-seq
MIRT858718 hsa-miR-181b CLIP-seq
MIRT858719 hsa-miR-181c CLIP-seq
MIRT858720 hsa-miR-181d CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
VDR Activation 1317496
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
55
GO ID Ontology Definition Evidence Reference
GO:0005499 Function Vitamin D binding IEA
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 30289411
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding IMP 18359862
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
114050 1434 ENSG00000104327
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P05937
Protein name Calbindin (Calbindin D28) (D-28K) (Vitamin D-dependent calcium-binding protein, avian-type)
Protein function Buffers cytosolic calcium. May stimulate a membrane Ca(2+)-ATPase and a 3',5'-cyclic nucleotide phosphodiesterase.
PDB 6FIE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13499 EF-hand_7 101 171 EF-hand domain pair Domain
PF00036 EF-hand_1 190 218 EF hand Domain
Sequence
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKT
FVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIET
EELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLL
PVQENFLLK
FQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMA
LSDGGKLYRTDLALILCAGDN
Sequence length 261
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Endocrine and other factor-regulated calcium reabsorption   Amyloid fiber formation