Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7920
Gene name Gene Name - the full gene name approved by the HGNC.
Abhydrolase domain containing 16A, phospholipase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ABHD16A
Synonyms (NCBI Gene) Gene synonyms aliases
BAT5, D6S82E, NG26, PP199, SPG86, hBAT5
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for tumor necrosis factor alpha and tumor necrosis factor beta. These genes are all within the human major histocompatibility complex class III region. The protein encoded by t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020741 hsa-miR-155-5p Proteomics 18668040
MIRT044614 hsa-miR-320a CLASH 23622248
MIRT733181 hsa-miR-4646-5p Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting 33875796
MIRT759680 hsa-miR-1182 CLIP-seq
MIRT759681 hsa-miR-1193 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004620 Function Phospholipase activity IBA
GO:0004620 Function Phospholipase activity IEA
GO:0004620 Function Phospholipase activity ISS
GO:0004622 Function Phosphatidylcholine lysophospholipase activity IDA 25290914
GO:0005515 Function Protein binding IPI 14667819, 25416956, 29892012, 31515488, 32296183, 36217029
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142620 13921 ENSG00000204427
Protein
UniProt ID O95870
Protein name Phosphatidylserine lipase ABHD16A (EC 3.1.-.-) (Alpha/beta hydrolase domain-containing protein 16A) (Abhydrolase domain-containing protein 16A) (HLA-B-associated transcript 5) (hBAT5) (Monoacylglycerol lipase ABHD16A) (EC 3.1.1.23) (Protein G5)
Protein function Phosphatidylserine (PS) lipase that mediates the hydrolysis of phosphatidylserine to generate lysophosphatidylserine (LPS) (By similarity). LPS constitutes a class of signaling lipids that regulates immunological and neurological processes (By s
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00561 Abhydrolase_1 280 415 alpha/beta hydrolase fold Domain
Sequence
MAKLLSCVLGPRLYKIYRERDSERAPASVPETPTAVTAPHSSSWDTYYQPRALEKHADSI
LALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLLLLAGVACLRGIGRWT
NPQYRQFITILEATHRNQSSENKRQLANYNFDFRSWPVDFHWEEPSSRKESRGGPSRRGV
ALLRPEPLHRGTADTLLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQG
QARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTP
LEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFT
ATWAAMSYPDVSAMILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLNNAEQL
CRYQG
PVLLIRRTKDEIITTTVPEDIMSNRGNDLLLKLLQHRYPRVMAEEGLRVVRQWLEASSQL
EEASIYSRWEVEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFE
ATHCTPLPAQNFQMPWHL
Sequence length 558
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Glycerolipid metabolism
Metabolic pathways
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Spastic Paraplegia spastic paraplegia 86, autosomal recessive N/A N/A GenCC
Takayasu Arteritis Takayasu arteritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Curatolo Cilio Pessagno syndrome Associate 34587489
Developmental Disabilities Associate 34587489
Intellectual Disability Associate 34587489
Muscle Spasticity Associate 34587489
Spastic Paraplegia Hereditary Associate 34587489