Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79192
Gene name Gene Name - the full gene name approved by the HGNC.
Iroquois homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IRX1
Synonyms (NCBI Gene) Gene synonyms aliases
IRX-5, IRXA1
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p15.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the Iroquois homeobox protein family. Homeobox genes in this family are involved in pattern formation in the embryo. The gene product has been identified as a tumor suppressor in gastric (PMID: 21602894, 20440264) and head an
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1072254 hsa-miR-3153 CLIP-seq
MIRT1072255 hsa-miR-4311 CLIP-seq
MIRT1072256 hsa-miR-4731-3p CLIP-seq
MIRT1072257 hsa-miR-4801 CLIP-seq
MIRT1072258 hsa-miR-625 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 20440264
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606197 14358 ENSG00000170549
Protein
UniProt ID P78414
Protein name Iroquois-class homeodomain protein IRX-1 (Homeodomain protein IRXA1) (Iroquois homeobox protein 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05920 Homeobox_KN 145 184 Homeobox KN domain Family
Sequence
MSFPQLGYPQYLSAAGPGAYGGERPGVLAAAAAAAAAASSGRPGAAELGGGAGAAAVTSV
LGMYAAAGPYAGAPNYSAFLPYAADLSLFSQMGSQYELKDNPGVHPATFAAHTAPAYYPY
GQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFAN
ARRR
LKKENKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQ
SNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDSPLGLAKEAPEPGSTRLLSPG
AAAGGLQGAPHGKPKIWSLAETATSPDGAPKASPPPPAGHPGAHGPSAGAPLQHPAFLPS
HGLYTCHIGKFSNWTNSAFLAQGSLLNMRSFLGVGAPHAAPHGPHLPAPPPPQPPVAIAP
GALNGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPSA
Sequence length 480
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Metabolic Syndrome Serum bilirubin levels in metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Juvenile Associate 26815016
Arthritis Rheumatoid Associate 23456299, 26815016
Carcinoma Ductal Associate 33667646
Carcinoma Non Small Cell Lung Associate 33859751
Down Syndrome Associate 38513239
Emanuel syndrome Associate 27175594
Graves Ophthalmopathy Associate 32908802
Keloid Associate 35047146
Leukemia Associate 27175594
Leukemia Myeloid Acute Associate 33219204, 35328612