Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79172
Gene name Gene Name - the full gene name approved by the HGNC.
Centromere protein O
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CENPO
Synonyms (NCBI Gene) Gene synonyms aliases
CENP-O, ICEN-36, MCM21R
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a component of the interphase centromere complex. The encoded protein is localized to the centromere throughout the cell cycle and is required for bipolar spindle assembly, chromosome segregation and checkpoint signaling during mitosis.
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024229 hsa-miR-218-5p Sequencing 20371350
MIRT712567 hsa-miR-181b-5p HITS-CLIP 19536157
MIRT712566 hsa-miR-181c-5p HITS-CLIP 19536157
MIRT712565 hsa-miR-181d-5p HITS-CLIP 19536157
MIRT712564 hsa-miR-4262 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000778 Component Condensed nuclear chromosome kinetochore IBA 21873635
GO:0005515 Function Protein binding IPI 16189514, 19447967, 25416956, 26496610, 28514442, 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0005654 Component Nucleoplasm TAS
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611504 28152 ENSG00000138092
Protein
UniProt ID Q9BU64
Protein name Centromere protein O (CENP-O) (Interphase centromere complex protein 36)
Protein function Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesiz
PDB 7PB8 , 7PKN , 7QOO , 7R5S , 7R5V , 7XHN , 7XHO , 7YWX , 7YYH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09496 CENP-O 119 268 Cenp-O kinetochore centromere component Family
Sequence
MEQANPLRPDGESKGGVLAHLERLETQVSRSRKQSEELQSVQAQEGALGTKIHKLRRLRD
ELRAVVRHRRASVKACIANVEPNQTVEINEQEALEEKLENVKAILQAYHFTGLSGKLTSR
GVCVCISTAFEGNLLDSYFVDLVIQKPLRIHHHSVPVFIPLEEIAAKYLQTNIQHFLFSL
CEYLNAYSGRKYQADRLQSDFAALLTGPLQRNPLCNLLSFTYKLDPGGQSFPFCARLLYK
DLTATLPTDVTVTCQGVEVLSTSWEEQR
ASHETLFCTKPLHQVFASFTRKGEKLDMSLVS
Sequence length 300
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Deposition of new CENPA-containing nucleosomes at the centromere
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Coronary artery disease Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537 29212778
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)
24076602
Unknown
Disease term Disease name Evidence References Source
Multiple Sclerosis Multiple Sclerosis GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37061713, 37558987
Breast Neoplasms Associate 39684488
Carcinogenesis Associate 37061713
Carcinoma Hepatocellular Associate 36107579
Neoplasm Metastasis Associate 37558987
Neoplasms Associate 37061713, 37558987