Gene Gene information from NCBI Gene database.
Entrez ID 79172
Gene name Centromere protein O
Gene symbol CENPO
Synonyms (NCBI Gene)
CENP-OICEN-36MCM21R
Chromosome 2
Chromosome location 2p23.3
Summary This gene encodes a component of the interphase centromere complex. The encoded protein is localized to the centromere throughout the cell cycle and is required for bipolar spindle assembly, chromosome segregation and checkpoint signaling during mitosis.
miRNA miRNA information provided by mirtarbase database.
313
miRTarBase ID miRNA Experiments Reference
MIRT024229 hsa-miR-218-5p Sequencing 20371350
MIRT712567 hsa-miR-181b-5p HITS-CLIP 19536157
MIRT712566 hsa-miR-181c-5p HITS-CLIP 19536157
MIRT712565 hsa-miR-181d-5p HITS-CLIP 19536157
MIRT712564 hsa-miR-4262 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IEA
GO:0000939 Component Inner kinetochore IPI 36085283
GO:0005515 Function Protein binding IPI 16189514, 19447967, 25416956, 26496610, 28514442, 32296183, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611504 28152 ENSG00000138092
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BU64
Protein name Centromere protein O (CENP-O) (Interphase centromere complex protein 36)
Protein function Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesiz
PDB 7PB8 , 7PKN , 7QOO , 7R5S , 7R5V , 7XHN , 7XHO , 7YWX , 7YYH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09496 CENP-O 119 268 Cenp-O kinetochore centromere component Family
Sequence
MEQANPLRPDGESKGGVLAHLERLETQVSRSRKQSEELQSVQAQEGALGTKIHKLRRLRD
ELRAVVRHRRASVKACIANVEPNQTVEINEQEALEEKLENVKAILQAYHFTGLSGKLTSR
GVCVCISTAFEGNLLDSYFVDLVIQKPLRIHHHSVPVFIPLEEIAAKYLQTNIQHFLFSL
CEYLNAYSGRKYQADRLQSDFAALLTGPLQRNPLCNLLSFTYKLDPGGQSFPFCARLLYK
DLTATLPTDVTVTCQGVEVLSTSWEEQR
ASHETLFCTKPLHQVFASFTRKGEKLDMSLVS
Sequence length 300
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Deposition of new CENPA-containing nucleosomes at the centromere
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation