Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79155
Gene name	TNFAIP3 interacting protein 2
Gene symbol	TNIP2
Synonyms (NCBI Gene)	ABIN2FLIP1KLIP
Chromosome	4
Chromosome location	4p16.3
Summary	This gene encodes a protein which acts as an inhibitor of NFkappaB activation. The encoded protein is also involved in MAP/ERK signaling pathway in specific cell types. It may be involved in apoptosis of endothelial cells. Alternative splicing results in

107

Show/Hide all (107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024247	hsa-miR-218-5p	Sequencing	20371350
MIRT030507	hsa-miR-24-3p	Microarray	19748357
MIRT562956	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT562955	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT562954	hsa-miR-548ab	PAR-CLIP	20371350
MIRT562953	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT562952	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT562951	hsa-miR-548ak	PAR-CLIP	20371350
MIRT562950	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT562949	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT562948	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT562947	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT562946	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT562945	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT562944	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT562943	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT562942	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT562941	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT562940	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT562939	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT562938	hsa-miR-548i	PAR-CLIP	20371350
MIRT562937	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT562936	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT562935	hsa-miR-548w	PAR-CLIP	20371350
MIRT562934	hsa-miR-548y	PAR-CLIP	20371350
MIRT562933	hsa-miR-559	PAR-CLIP	20371350
MIRT562932	hsa-miR-548av-5p	PAR-CLIP	20371350
MIRT562931	hsa-miR-548k	PAR-CLIP	20371350
MIRT562930	hsa-miR-8054	PAR-CLIP	20371350
MIRT562929	hsa-miR-548l	PAR-CLIP	20371350
MIRT562928	hsa-miR-595	PAR-CLIP	20371350
MIRT562927	hsa-miR-648	PAR-CLIP	20371350
MIRT562926	hsa-miR-3163	PAR-CLIP	20371350
MIRT562925	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT562924	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT562923	hsa-miR-636	PAR-CLIP	20371350
MIRT562922	hsa-miR-6800-5p	PAR-CLIP	20371350
MIRT562921	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT562920	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT024247	hsa-miR-218-5p	PAR-CLIP	20371350
MIRT736539	hsa-miR-423-5p	Western blottingqRT-PCR	32606763
MIRT562956	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT562955	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT562954	hsa-miR-548ab	PAR-CLIP	20371350
MIRT562953	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT562952	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT562951	hsa-miR-548ak	PAR-CLIP	20371350
MIRT562950	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT562949	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT562948	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT562947	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT562946	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT562945	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT562944	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT562943	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT562942	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT562941	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT562940	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT562939	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT562938	hsa-miR-548i	PAR-CLIP	20371350
MIRT562937	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT562936	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT562935	hsa-miR-548w	PAR-CLIP	20371350
MIRT562934	hsa-miR-548y	PAR-CLIP	20371350
MIRT562933	hsa-miR-559	PAR-CLIP	20371350
MIRT562932	hsa-miR-548av-5p	PAR-CLIP	20371350
MIRT562931	hsa-miR-548k	PAR-CLIP	20371350
MIRT562930	hsa-miR-8054	PAR-CLIP	20371350
MIRT562929	hsa-miR-548l	PAR-CLIP	20371350
MIRT562928	hsa-miR-595	PAR-CLIP	20371350
MIRT562927	hsa-miR-648	PAR-CLIP	20371350
MIRT562926	hsa-miR-3163	PAR-CLIP	20371350
MIRT562925	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT562924	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT562923	hsa-miR-636	PAR-CLIP	20371350
MIRT562922	hsa-miR-6800-5p	PAR-CLIP	20371350
MIRT562921	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT562920	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT024247	hsa-miR-218-5p	PAR-CLIP	20371350
MIRT1443630	hsa-miR-103b	CLIP-seq
MIRT1443631	hsa-miR-15a	CLIP-seq
MIRT1443632	hsa-miR-15b	CLIP-seq
MIRT1443633	hsa-miR-16	CLIP-seq
MIRT1443634	hsa-miR-195	CLIP-seq
MIRT1443635	hsa-miR-339-5p	CLIP-seq
MIRT1443636	hsa-miR-3609	CLIP-seq
MIRT1443637	hsa-miR-383	CLIP-seq
MIRT1443638	hsa-miR-424	CLIP-seq
MIRT1443639	hsa-miR-4475	CLIP-seq
MIRT1443640	hsa-miR-451b	CLIP-seq
MIRT1443641	hsa-miR-4662a-5p	CLIP-seq
MIRT1443642	hsa-miR-4704-3p	CLIP-seq
MIRT1443643	hsa-miR-497	CLIP-seq
MIRT1443644	hsa-miR-520g	CLIP-seq
MIRT1443645	hsa-miR-520h	CLIP-seq
MIRT1443646	hsa-miR-548ah	CLIP-seq
MIRT1443647	hsa-miR-587	CLIP-seq
MIRT1443648	hsa-miR-670	CLIP-seq
MIRT1443649	hsa-miR-759	CLIP-seq
MIRT1443631	hsa-miR-15a	CLIP-seq
MIRT1443632	hsa-miR-15b	CLIP-seq
MIRT1443633	hsa-miR-16	CLIP-seq
MIRT1443634	hsa-miR-195	CLIP-seq
MIRT1443638	hsa-miR-424	CLIP-seq
MIRT1443640	hsa-miR-451b	CLIP-seq
MIRT1443642	hsa-miR-4704-3p	CLIP-seq
MIRT1443643	hsa-miR-497	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12595760, 12753905, 14653779, 14743216, 15169888, 15474016, 21988832, 25609649, 25852190, 28514442, 30561431, 33961781, 35140242
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0019901	Function	Protein kinase binding	IDA	21784860
GO:0023035	Process	CD40 signaling pathway	IEA
GO:0023035	Process	CD40 signaling pathway	ISS
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IDA	18212736
GO:0034134	Process	Toll-like receptor 2 signaling pathway	IBA
GO:0034134	Process	Toll-like receptor 2 signaling pathway	IEA
GO:0034134	Process	Toll-like receptor 2 signaling pathway	ISS
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IBA
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IEA
GO:0034138	Process	Toll-like receptor 3 signaling pathway	ISS
GO:0034162	Process	Toll-like receptor 9 signaling pathway	IEA
GO:0034162	Process	Toll-like receptor 9 signaling pathway	ISS
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043032	Process	Positive regulation of macrophage activation	ISS
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	21784860
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12753905
GO:0046872	Function	Metal ion binding	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0050871	Process	Positive regulation of B cell activation	IEA
GO:0050871	Process	Positive regulation of B cell activation	ISS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	ISS
GO:0070530	Function	K63-linked polyubiquitin modification-dependent protein binding	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	12933576

MIM	HGNC	e!Ensembl
610669	19118	ENSG00000168884

Q8NFZ5

Protein name

TNFAIP3-interacting protein 2 (A20-binding inhibitor of NF-kappa-B activation 2) (ABIN-2) (Fetal liver LKB1-interacting protein)

Protein function

Inhibits NF-kappa-B activation by blocking the interaction of RIPK1 with its downstream effector NEMO/IKBKG. Forms a ternary complex with NFKB1 and MAP3K8 but appears to function upstream of MAP3K8 in the TLR4 signaling pathway that regulates MA

PDB

5H07

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12180	EABR	214 → 247	TSG101 and ALIX binding domain of CEP55	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in all tissues examined. {ECO:0000269|PubMed:12595760}.

Sequence

MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAA
PSLVDALLEQVARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHERE
KEVVLLRRSMAEGERARAASDVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQR
NVGERSPDQSEHTDGHTSVQSVIEKLQEENRLLKQKVTHVEDLNAKWQRYNASRDEYVRG
LHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQMLE
QQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHAGSKTAK
YLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSDEQGEEL
LRHVAECCQ

Sequence length

429

Interactions

View interactions

	Reactome
			MAP3K8 (TPL2)-dependent MAPK1/3 activation Ovarian tumor domain proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Lymphoma B Cell Marginal Zone	Associate	22207688	★★★★★ ★☆☆☆☆ Found in Text Mining only

TNIP2 (TNFAIP3 interacting protein 2)