Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79153
Gene name Gene Name - the full gene name approved by the HGNC.	Glycerophosphodiester phosphodiesterase domain containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GDPD3
Synonyms (NCBI Gene) Gene synonyms aliases	GDE7
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p11.2

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1016052	hsa-miR-873	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	IMP	27637550
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0008081	Function	Phosphoric diester hydrolase activity	IBA
GO:0008081	Function	Phosphoric diester hydrolase activity	IEA
GO:0008081	Function	Phosphoric diester hydrolase activity	IMP	27637550
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0034638	Process	Phosphatidylcholine catabolic process	IEA
GO:0046475	Process	Glycerophospholipid catabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070291	Process	N-acylethanolamine metabolic process	IEA
GO:0070291	Process	N-acylethanolamine metabolic process	IMP	27637550

MIM	HGNC	e!Ensembl
616318	28638	ENSG00000102886

Protein

UniProt ID

Q7L5L3

Protein name

Lysophospholipase D GDPD3 (EC 3.1.4.-) (Glycerophosphodiester phosphodiesterase 7) (Glycerophosphodiester phosphodiesterase domain-containing protein 3)

Protein function

Hydrolyzes lysoglycerophospholipids to produce lysophosphatidic acid (LPA) and the corresponding amines (PubMed:27637550). Shows a preference for 1-O-alkyl-sn-glycero-3-phosphocholine (lyso-PAF), lysophosphatidylcholine (lyso-PC) and N-acylethan

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03009	GDPD	44 → 303	Glycerophosphoryl diester phosphodiesterase family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with high level in kidney and ovary. {ECO:0000269|PubMed:27637550}.

Sequence

MSLLLYYALPALGSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAME
NSMAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFS
PGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASE
KSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFP
FSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDY
PTALRHYLDNHGPAARTS

Sequence length

318

Interactions

View interactions

	KEGG
	Ether lipid metabolism Metabolic pathways

GDPD3 (glycerophosphodiester phosphodiesterase domain containing 3)