Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79133
Gene name Gene Name - the full gene name approved by the HGNC.
NADH:ubiquinone oxidoreductase complex assembly factor 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NDUFAF5
Synonyms (NCBI Gene) Gene synonyms aliases
C20orf7, MC1DN16, bA526K24.2, dJ842G6.1
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p12.1
Summary Summary of gene provided in NCBI Entrez Gene.
The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. Th
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs118203929 T>C Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs150613320 G>C Conflicting-interpretations-of-pathogenicity 5 prime UTR variant, missense variant, coding sequence variant, non coding transcript variant
rs150955045 T>C Conflicting-interpretations-of-pathogenicity, likely-benign Coding sequence variant, non coding transcript variant, synonymous variant
rs267606689 A>C Pathogenic 5 prime UTR variant, missense variant, coding sequence variant, intron variant, non coding transcript variant
rs746405080 G>A Likely-pathogenic Coding sequence variant, non coding transcript variant, 5 prime UTR variant, missense variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004497 Function Monooxygenase activity ISS
GO:0005515 Function Protein binding IPI 27226634, 27499296, 28514442, 33961781, 35614220
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA 27226634
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612360 15899 ENSG00000101247
Protein
UniProt ID Q5TEU4
Protein name Arginine-hydroxylase NDUFAF5, mitochondrial (EC 1.-.-.-) (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5) (Putative methyltransferase NDUFAF5) (EC 2.1.1.-)
Protein function Arginine hydroxylase that mediates hydroxylation of 'Arg-111' of NDUFS7 and is involved in the assembly of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I, MT-ND1) at early stages (PubMed:18940309, PubMed:27226634). May also have
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08241 Methyltransf_11 94 186 Methyltransferase domain Domain
Sequence
MLRPAGLWRLCRRPWAARVPAENLGRREVTSGVSPRGSTSPRTLNIFDRDLKRKQKNWAA
RQPEPTKFDYLKEEVGSRIADRVYDIPRNFPLALDLGCGRGYIAQYLNKETIGKFFQADI
AENALKNSSETEIPTVSVLADEEFLPFKENTFDLVVSSLSLHWVNDLPRALEQIHYILKP
DGVFIG
AMFGGDTLYELRCSLQLAETEREGGFSPHISPFTAVNDLGHLLGRAGFNTLTVD
TDEIQVNYPGMFELMEDLQGMGESNCAWNRKALLHRDTMLAAAAVYREMYRNEDGSVPAT
YQIYYMIGWKYHESQARPAERGSATVSFGELGKINNLMPPGKKSQ
Sequence length 345
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Thermogenesis   Complex I biogenesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Leber Plus Disease leber plus disease rs1555830705 N/A
leigh syndrome Leigh syndrome rs761389904, rs150613320 N/A
Mitochondrial Complex Deficiency Mitochondrial complex 1 deficiency, nuclear type 16, mitochondrial complex i deficiency, Mitochondrial complex I deficiency, nuclear type 1 rs531254130, rs1555834773, rs761389904, rs1600305570, rs150613320, rs118203929, rs757043077, rs267606689, rs576780935 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Leigh Syndrome With Leukodystrophy Leigh syndrome with leukodystrophy N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Callosities Associate 37718619
Congenital Abnormalities Associate 37718619
COVID 19 Associate 33173052
Cysts Associate 37718619
Death Associate 34964562
Dyspnea Associate 29581464
Fetal Growth Retardation Associate 37718619
Hydrops Fetalis Associate 37718619
Hypersensitivity Delayed Associate 29581464
Hyponatremia Associate 30473481