Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79132
Gene name Gene Name - the full gene name approved by the HGNC.	DExH-box helicase 58
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DHX58
Synonyms (NCBI Gene) Gene synonyms aliases	D11LGP2, D11lgp2e, LGP2, RLR-3
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.2

Show/Hide all(8)

miRTarBase ID	miRNA	Experiments
MIRT935733	hsa-miR-3150b-3p	CLIP-seq
MIRT935734	hsa-miR-4689	CLIP-seq
MIRT935735	hsa-miR-4729	CLIP-seq
MIRT935736	hsa-miR-4784	CLIP-seq
MIRT2212395	hsa-miR-1254	CLIP-seq
MIRT2212396	hsa-miR-2861	CLIP-seq
MIRT2212397	hsa-miR-3116	CLIP-seq
MIRT2212398	hsa-miR-4446-5p	CLIP-seq

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003724	Function	RNA helicase activity	IEA
GO:0003725	Function	Double-stranded RNA binding	IBA	21873635
GO:0003725	Function	Double-stranded RNA binding	IDA	18411269
GO:0003727	Function	Single-stranded RNA binding	IBA	21873635
GO:0003727	Function	Single-stranded RNA binding	IDA	18411269
GO:0005515	Function	Protein binding	IPI	17190814, 19403670, 21791617, 21903422, 25340845, 30833792
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0008270	Function	Zinc ion binding	IBA	21873635
GO:0008270	Function	Zinc ion binding	IDA	19278996
GO:0009615	Process	Response to virus	IBA	21873635
GO:0009615	Process	Response to virus	ISS
GO:0009617	Process	Response to bacterium	IEA
GO:0016032	Process	Viral process	IEA
GO:0032480	Process	Negative regulation of type I interferon production	IDA	21525357
GO:0032481	Process	Positive regulation of type I interferon production	ISS
GO:0032728	Process	Positive regulation of interferon-beta production	IBA	21873635
GO:0039534	Process	Negative regulation of MDA-5 signaling pathway	IMP	21187438
GO:0039536	Process	Negative regulation of RIG-I signaling pathway	IDA	18411269
GO:0039536	Process	Negative regulation of RIG-I signaling pathway	IMP	21187438
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045088	Process	Regulation of innate immune response	IDA	18411269
GO:0045824	Process	Negative regulation of innate immune response	IDA	21525357
GO:0051607	Process	Defense response to virus	IEA
GO:1900245	Process	Positive regulation of MDA-5 signaling pathway	ISS
GO:1900246	Process	Positive regulation of RIG-I signaling pathway	ISS

MIM	HGNC	e!Ensembl
608588	29517	ENSG00000108771

Protein

UniProt ID

Q96C10

Protein name

ATP-dependent RNA helicase DHX58 (EC 3.6.4.13) (ATP-dependent helicase LGP2) (Protein D11Lgp2 homolog) (RIG-I-like receptor 3) (RLR-3) (RIG-I-like receptor LGP2) (RLR)

Protein function

Acts as a regulator of RIGI and IFIH1/MDA5 mediated antiviral signaling. Cannot initiate antiviral signaling as it lacks the CARD domain required for activating MAVS/IPS1-dependent signaling events. Can have both negative and positive regulatory

PDB

2RQA , 2W4R , 3EQT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04851	ResIII	1 → 172	Type III restriction enzyme, res subunit	Family
PF18119	RIG-I_C	215 → 343	RIG-I receptor C-terminal domain	Domain
PF00271	Helicase_C	349 → 475	Helicase conserved C-terminal domain	Family
PF11648	RIG-I_C-RD	552 → 667	C-terminal domain of RIG-I	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis, nerve and spleen. Also expressed in the brain. {ECO:0000269|PubMed:31256877}.

Sequence

MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLV
TQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHV
ELTVFSLIVVDECHHTHKDTVYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDG
AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQI
HDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAV
DALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPKLEMLEKILQR
QFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ
QEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYA
FVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQR
ENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKV
FKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVP
DFDFLQHCAENLSDLSLD

Sequence length

678

Interactions

View interactions

	KEGG		Reactome
	RIG-I-like receptor signaling pathway		DDX58/IFIH1-mediated induction of interferon-alpha/beta

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	29212778

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Alzheimer disease	Alzheimer disease			GWAS

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	33401559
Alzheimer Disease	Associate	40194700
Carcinogenesis	Associate	36076988
Carcinoma Hepatocellular	Associate	36152765, 39265845
Coronary Artery Disease	Inhibit	40135555
COVID 19	Associate	33440148, 33867526, 34249006
Cytokine Release Syndrome	Associate	33867526
Cytomegalovirus Infections	Associate	39331212
Diabetes Mellitus Type 2	Associate	31932636
Fibrosis	Associate	36152765
Frontotemporal Dementia	Associate	30739198
Hepatitis D	Associate	36152765
Hepatitis D Chronic	Associate	36152765
Infections	Associate	24390337, 31235738, 36076988, 37656756
Inflammation	Associate	23545497, 36076988
Influenza Human	Associate	32898178
Lupus Erythematosus Systemic	Associate	29321042, 31790472
Neoplasm Metastasis	Associate	39265845
Neoplasms	Associate	33401559, 34897916, 35156720
Primary Immunodeficiency Diseases	Associate	33867526
RNA Virus Infections	Associate	30021902
Triple Negative Breast Neoplasms	Associate	34897916
Virus Diseases	Associate	29939295

DHX58 (DExH-box helicase 58)