Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7913
Gene name Gene Name - the full gene name approved by the HGNC.
DEK proto-oncogene
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DEK
Synonyms (NCBI Gene) Gene synonyms aliases
D6S231E
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. Chromosomal aberrations i
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016065 hsa-miR-374b-5p Sequencing 20371350
MIRT020832 hsa-miR-155-5p Proteomics 18668040
MIRT024668 hsa-miR-215-5p Microarray 19074876
MIRT026606 hsa-miR-192-5p Microarray 19074876
MIRT048732 hsa-miR-96-5p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
YY1 Unknown 12483538
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IDA 21653549
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
125264 2768 ENSG00000124795
Protein
UniProt ID P35659
Protein name Protein DEK
Protein function Involved in chromatin organization.
PDB 1Q1V , 2JX3 , 8KCY , 8KD1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08766 DEK_C 320 374 DEK C terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Expressed at relatively high levels.
Sequence
MSASAPAAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEGKREK
KKVERLTMQVSSLQREPFTIAQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPGTV
SSLKKNVGQFSGFPFEKGSVQYKKKEEMLKKFRNAMLKSICEVLDLERSGVNSELVKRIL
NFLMHPKPSGKPLPKSKKTCSKGSKKERNSSGMARKAKRTKCPEILSDESSSDEDEKKNK
EESSDDEDKESEEEPPKKTAKREKPKQKATSKSKKSVKSANVKKADSSTTKKNQNSSKKE
SESEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLT
ERKDFIKTTVKELI
S
Sequence length 375
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    B-WICH complex positively regulates rRNA expression
Transcriptional regulation by the AP-2 (TFAP2) family of transcription factors
Transcriptional regulation of granulopoiesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
27811057
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
27811057
Marfan syndrome Mammary Carcinoma, Human rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465
View all (942 more)
27811057
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Stimulate 23571382
Alzheimer Disease Associate 32736520, 35972263
Arthritis Associate 9050861
Arthritis Juvenile Associate 10908574, 12823858, 21280010, 9050861
Arthritis Rheumatoid Associate 15593216
Astrocytoma Associate 28670979
Ataxia Telangiectasia Associate 15238633, 7504406, 9050861
Autoimmune Diseases Associate 12823858, 15238633, 15987677, 16254365, 16829531, 22390170
Breast Neoplasms Associate 17855657, 23071688, 30758703, 36067206, 37550322
Carcinogenesis Associate 16254365, 16894028, 22390170, 23571382, 25197373, 27114368, 35972263, 36102441