Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79087
Gene name Gene Name - the full gene name approved by the HGNC.	ALG12 alpha-1,6-mannosyltransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ALG12
Synonyms (NCBI Gene) Gene synonyms aliases	CDG1G, ECM39, PP14673, hALG12
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for pro

Show/Hide all(13)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28942090	A>C	Pathogenic	Coding sequence variant, missense variant
rs113652023	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, missense variant
rs121907931	G>A	Pathogenic	Coding sequence variant, missense variant
rs121907932	C>T	Pathogenic	Coding sequence variant, missense variant
rs121907933	C>A,T	Pathogenic	Coding sequence variant, stop gained, missense variant
rs121907934	A>G	Pathogenic	Coding sequence variant, missense variant
rs121907935	G>A,C	Likely-benign, pathogenic	Intron variant, stop gained, synonymous variant, downstream transcript variant, genic downstream transcript variant, coding sequence variant
rs759244819	T>-	Pathogenic	Intron variant, frameshift variant, coding sequence variant
rs761221480	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs775856400	A>G	Likely-pathogenic	Intron variant, genic downstream transcript variant, downstream transcript variant, missense variant, coding sequence variant
rs1057517895	C>A	Likely-pathogenic	Splice donor variant
rs1555930118	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1569174722	GT>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017824	hsa-miR-335-5p	Microarray	18185580
MIRT778237	hsa-miR-1197	CLIP-seq
MIRT778238	hsa-miR-1285	CLIP-seq
MIRT778239	hsa-miR-1286	CLIP-seq
MIRT778240	hsa-miR-1291	CLIP-seq
MIRT778241	hsa-miR-1293	CLIP-seq
MIRT778242	hsa-miR-1827	CLIP-seq
MIRT778243	hsa-miR-1910	CLIP-seq
MIRT778244	hsa-miR-2467-5p	CLIP-seq
MIRT778245	hsa-miR-3121-5p	CLIP-seq
MIRT778246	hsa-miR-3187-5p	CLIP-seq
MIRT778247	hsa-miR-3188	CLIP-seq
MIRT778248	hsa-miR-331-3p	CLIP-seq
MIRT778249	hsa-miR-34a	CLIP-seq
MIRT778250	hsa-miR-34c-5p	CLIP-seq
MIRT778251	hsa-miR-3620	CLIP-seq
MIRT778252	hsa-miR-3661	CLIP-seq
MIRT778253	hsa-miR-3663-5p	CLIP-seq
MIRT778254	hsa-miR-3665	CLIP-seq
MIRT778255	hsa-miR-3690	CLIP-seq
MIRT778256	hsa-miR-3975	CLIP-seq
MIRT778257	hsa-miR-3977	CLIP-seq
MIRT778258	hsa-miR-4257	CLIP-seq
MIRT778259	hsa-miR-4292	CLIP-seq
MIRT778260	hsa-miR-4299	CLIP-seq
MIRT778261	hsa-miR-4308	CLIP-seq
MIRT778262	hsa-miR-4436a	CLIP-seq
MIRT778263	hsa-miR-4456	CLIP-seq
MIRT778264	hsa-miR-4483	CLIP-seq
MIRT778265	hsa-miR-449a	CLIP-seq
MIRT778266	hsa-miR-449b	CLIP-seq
MIRT778267	hsa-miR-4527	CLIP-seq
MIRT778268	hsa-miR-4535	CLIP-seq
MIRT778269	hsa-miR-4649-3p	CLIP-seq
MIRT778270	hsa-miR-4695-5p	CLIP-seq
MIRT778271	hsa-miR-4701-5p	CLIP-seq
MIRT778272	hsa-miR-4736	CLIP-seq
MIRT778273	hsa-miR-485-5p	CLIP-seq
MIRT778274	hsa-miR-492	CLIP-seq
MIRT778275	hsa-miR-541	CLIP-seq
MIRT778276	hsa-miR-548q	CLIP-seq
MIRT778277	hsa-miR-588	CLIP-seq
MIRT778278	hsa-miR-612	CLIP-seq
MIRT778279	hsa-miR-631	CLIP-seq
MIRT778280	hsa-miR-654-5p	CLIP-seq
MIRT778281	hsa-miR-764	CLIP-seq
MIRT778282	hsa-miR-765	CLIP-seq
MIRT778283	hsa-miR-940	CLIP-seq
MIRT1929717	hsa-miR-125a-5p	CLIP-seq
MIRT1929718	hsa-miR-125b	CLIP-seq
MIRT778248	hsa-miR-331-3p	CLIP-seq
MIRT1929719	hsa-miR-342-5p	CLIP-seq
MIRT1929720	hsa-miR-4319	CLIP-seq
MIRT1929721	hsa-miR-4324	CLIP-seq
MIRT1929722	hsa-miR-4664-5p	CLIP-seq
MIRT1929723	hsa-miR-4729	CLIP-seq
MIRT2170538	hsa-miR-1273	CLIP-seq
MIRT778238	hsa-miR-1285	CLIP-seq
MIRT778246	hsa-miR-3187-5p	CLIP-seq
MIRT778253	hsa-miR-3663-5p	CLIP-seq
MIRT2170539	hsa-miR-378g	CLIP-seq
MIRT2170540	hsa-miR-4486	CLIP-seq
MIRT778267	hsa-miR-4527	CLIP-seq
MIRT2170541	hsa-miR-4649-5p	CLIP-seq
MIRT2170542	hsa-miR-4663	CLIP-seq
MIRT2170543	hsa-miR-4704-3p	CLIP-seq
MIRT778278	hsa-miR-612	CLIP-seq
MIRT1929717	hsa-miR-125a-5p	CLIP-seq
MIRT1929718	hsa-miR-125b	CLIP-seq
MIRT2384085	hsa-miR-3160-3p	CLIP-seq
MIRT1929720	hsa-miR-4319	CLIP-seq
MIRT2384086	hsa-miR-4487	CLIP-seq
MIRT2384087	hsa-miR-558	CLIP-seq
MIRT2384088	hsa-miR-671-5p	CLIP-seq
MIRT1929719	hsa-miR-342-5p	CLIP-seq
MIRT2473102	hsa-miR-4447	CLIP-seq
MIRT2473103	hsa-miR-4466	CLIP-seq
MIRT2473104	hsa-miR-4472	CLIP-seq
MIRT1929722	hsa-miR-4664-5p	CLIP-seq
MIRT2473105	hsa-miR-4733-3p	CLIP-seq
MIRT2473106	hsa-miR-675	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000009	Function	Alpha-1,6-mannosyltransferase activity	IBA
GO:0000030	Function	Mannosyltransferase activity	TAS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	NAS	12217961
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006457	Process	Protein folding	NAS	12217961
GO:0006486	Process	Protein glycosylation	IEA
GO:0006487	Process	Protein N-linked glycosylation	IBA
GO:0006487	Process	Protein N-linked glycosylation	IMP	11983712, 12093361
GO:0006488	Process	Dolichol-linked oligosaccharide biosynthetic process	IDA	11983712
GO:0006488	Process	Dolichol-linked oligosaccharide biosynthetic process	IMP	11983712, 12093361
GO:0006488	Process	Dolichol-linked oligosaccharide biosynthetic process	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0052917	Function	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase activity	IEA
GO:0052917	Function	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase activity	IMP	11983712, 12093361
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	IC	12217961

MIM	HGNC	e!Ensembl
607144	19358	ENSG00000182858

Protein

UniProt ID

Q9BV10

Protein name

Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase (EC 2.4.1.260) (Asparagine-linked glycosylation protein 12 homolog) (hALG12) (Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase) (Mannosyltransferase ALG12 homolog) (Mem

Protein function

Mannosyltransferase that operates in the biosynthetic pathway of dolichol-linked oligosaccharides, the glycan precursors employed in protein asparagine (N)-glycosylation. The assembly of dolichol-linked oligosaccharides begins on the cytosolic s

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03901	Glyco_transf_22	13 → 406	Alg9-like mannosyltransferase family	Family

Sequence

MAGKGSSGRRPLLLGLLVAVATVHLVICPYTKVEESFNLQATHDLLYHWQDLEQYDHLEF
PGVVPRTFLGPVVIAVFSSPAVYVLSLLEMSKFYSQLIVRGVLGLGVIFGLWTLQKEVRR
HFGAMVATMFCWVTAMQFHLMFYCTRTLPNVLALPVVLLALAAWLRHEWARFIWLSAFAI
IVFRVELCLFLGLLLLLALGNRKVSVVRALRHAVPAGILCLGLTVAVDSYFWRQLTWPEG
KVLWYNTVLNKSSNWGTSPLLWYFYSALPRGLGCSLLFIPLGLVDRRTHAPTVLALGFMA
LYSLLPHKELRFIIYAFPMLNITAARGCSYLLNNYKKSWLYKAGSLLVIGHLVVNAAYSA
TALYVSHFNYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDV
QPGTGMLAYTHILMEAAPGLLALYRDTHRVLASVVGTTGVSLNLTQLPPFNVHLQTKLVL
LERLPRPS

Sequence length

488

Interactions

View interactions

	KEGG		Reactome
	N-Glycan biosynthesis Various types of N-glycan biosynthesis Metabolic pathways		Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein Defective ALG12 causes ALG12-CDG (CDG-1g)

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
congenital disorder of glycosylation	Congenital disorder of glycosylation	N/A	N/A	ClinVar
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Cerebral Palsy	Associate	40243517
Clinical Deterioration	Associate	34467644
Congenital Disorder Of Glycosylation Type In	Associate	11983712, 34467644
Congenital Disorders of Glycosylation	Associate	26805780
Fructose Intolerance	Associate	35279850
Glycogen Storage Disease XIV	Associate	11983712, 34467644

ALG12 (ALG12 alpha-1,6-mannosyltransferase)