Gene Gene information from NCBI Gene database.
Entrez ID 79084
Gene name WD repeat domain 77
Gene symbol WDR77
Synonyms (NCBI Gene)
HKMT1069MEP-50MEP50Nbla10071p44p44/Mep50
Chromosome 1
Chromosome location 1p13.2
Summary The protein encoded by this gene is an androgen receptor coactivator that forms a complex with protein arginine methyltransferase 5, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. The encoded protein may be inv
miRNA miRNA information provided by mirtarbase database.
277
miRTarBase ID miRNA Experiments Reference
MIRT007024 hsa-miR-27a-3p Luciferase reporter assay 21558443
MIRT007024 hsa-miR-27a-3p Luciferase reporter assay 21558443
MIRT007024 hsa-miR-27a-3p Luciferase reporter assay 21558443
MIRT047356 hsa-miR-34a-5p CLASH 23622248
MIRT045318 hsa-miR-185-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IEA
GO:0000387 Process Spliceosomal snRNP assembly NAS 11756452
GO:0003713 Function Transcription coactivator activity IGI 12972618
GO:0005515 Function Protein binding IPI 11756452, 16087681, 19188445, 20951943, 22365833, 23071334, 23892143, 25284789, 26763441, 26912361, 27337956, 32814053, 33376131
GO:0005634 Component Nucleus IDA 21081503
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611734 29652 ENSG00000116455
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BQA1
Protein name Methylosome protein WDR77 (Androgen receptor cofactor p44) (Methylosome protein 50) (MEP-50) (WD repeat-containing protein 77) (p44/Mep50)
Protein function Non-catalytic component of the methylosome complex, composed of PRMT5, WDR77 and CLNS1A, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins and histones (PubMed:11756452). This modification targets Sm prot
PDB 4GQB , 4X60 , 4X61 , 4X63 , 5C9Z , 5EMJ , 5EMK , 5EML , 5EMM , 5FA5 , 6CKC , 6K1S , 6RLL , 6RLQ , 6UGH , 6UXX , 6UXY , 6V0N , 6V0O , 6V0P , 7BO7 , 7KIB , 7KIC , 7KID , 7L1G , 7M05 , 7MX7 , 7MXA , 7MXC , 7MXG , 7MXN , 7S0U , 7S1P , 7S1Q , 7S1R , 7S1S , 7SER , 7SES , 7U30 , 7UOH , 7UY1 , 7UYF , 7ZUP , 7ZUQ , 7ZUU , 7ZUY , 7ZV2 , 7ZVL , 7ZVU , 8CSG , 8CTB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 157 196 WD domain, G-beta repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle, spleen, testis, uterus, prostate and thymus. In testis, expressed in germ cells and Leydig cells, but not in peritubular myocytes, nor in Sertoli cells. Expressed in prostate cancers, in semi
Sequence
MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWL
FKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFC
KYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKD
SVFLSCSEDNRILLWD
TRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLV
DTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFV
RDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE
Sequence length 342
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    snRNP Assembly
RMTs methylate histone arginines