|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9BQA1 |
| Protein name |
Methylosome protein WDR77 (Androgen receptor cofactor p44) (Methylosome protein 50) (MEP-50) (WD repeat-containing protein 77) (p44/Mep50) |
| Protein function |
Non-catalytic component of the methylosome complex, composed of PRMT5, WDR77 and CLNS1A, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins and histones (PubMed:11756452). This modification targets Sm prot |
| PDB |
4GQB
, 4X60
, 4X61
, 4X63
, 5C9Z
, 5EMJ
, 5EMK
, 5EML
, 5EMM
, 5FA5
, 6CKC
, 6K1S
, 6RLL
, 6RLQ
, 6UGH
, 6UXX
, 6UXY
, 6V0N
, 6V0O
, 6V0P
, 7BO7
, 7KIB
, 7KIC
, 7KID
, 7L1G
, 7M05
, 7MX7
, 7MXA
, 7MXC
, 7MXG
, 7MXN
, 7S0U
, 7S1P
, 7S1Q
, 7S1R
, 7S1S
, 7SER
, 7SES
, 7U30
, 7UOH
, 7UY1
, 7UYF
, 7ZUP
, 7ZUQ
, 7ZUU
, 7ZUY
, 7ZV2
, 7ZVL
, 7ZVU
, 8CSG
, 8CTB
|
| Family and domains |
Pfam
| Accession |
ID |
Position in sequence |
Description |
Type |
| PF00400 |
WD40 |
157 → 196 |
WD domain, G-beta repeat |
Repeat |
|
| Tissue specificity |
TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle, spleen, testis, uterus, prostate and thymus. In testis, expressed in germ cells and Leydig cells, but not in peritubular myocytes, nor in Sertoli cells. Expressed in prostate cancers, in semi |
| Sequence |
MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWL FKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFC KYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKD SVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLV DTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFV RDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE
|
|
| Sequence length |
342 |
| Interactions |
View interactions |