KCTD15 (potassium channel tetramerization domain containing 15)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79047
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium channel tetramerization domain containing 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCTD15
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.11
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(743)
miRTarBase ID miRNA Experiments Reference
MIRT020375 hsa-miR-29c-3p Sequencing 20371350
MIRT021087 hsa-miR-186-5p Sequencing 20371350
MIRT024933 hsa-miR-215-5p Microarray 19074876
MIRT026293 hsa-miR-192-5p Microarray 19074876
MIRT050356 hsa-miR-25-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0003714 Function Transcription corepressor activity IBA
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053, 38113115
GO:0005634 Component Nucleus IEA
GO:0042802 Function Identical protein binding IEA
GO:0042802 Function Identical protein binding IPI 27152988
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
615240 23297 ENSG00000153885
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96SI1
Protein name BTB/POZ domain-containing protein KCTD15 (Potassium channel tetramerization domain-containing protein 15)
Protein function During embryonic development, it is involved in neural crest formation (By similarity). Inhibits AP2 transcriptional activity by interaction with its activation domain (PubMed:23382213). {ECO:0000250|UniProtKB:Q6DC02, ECO:0000269|PubMed:23382213
PDB 8PNM , 8PNR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02214 BTB_2 58 → 150 BTB/POZ domain Domain
Sequence 
MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHI
DVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTS
KLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGER
IALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRG
FSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQEPLD
Sequence length 283
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Endometriosis Endometriosis N/A N/A GWAS
Frontonasal Dysplasia frontonasal dysplasia N/A N/A GenCC
Mental Depression Major depressive disorder N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Show/Hide Text Mining Associations (19)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Pleomorphic Associate 31861025
Anorexia Associate 28948079
Anorexia Nervosa Associate 28948079
Bulimia Nervosa Associate 28948079
Cardiovascular Diseases Associate 19910641
Craniofacial Abnormalities Associate 38296633
Diabetes Mellitus Associate 34521919
Ectodermal Dysplasia Associate 38296633
Feeding and Eating Disorders Associate 28948079
Frontonasal dysplasia Associate 38296633