Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79004
Gene name Gene Name - the full gene name approved by the HGNC.
CUE domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CUEDC2
Synonyms (NCBI Gene) Gene synonyms aliases
C10orf66, bA18I14.5
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.32
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT045300 hsa-miR-186-5p CLASH 23622248
MIRT043568 hsa-miR-331-3p CLASH 23622248
MIRT043183 hsa-miR-324-5p CLASH 23622248
MIRT039666 hsa-miR-615-3p CLASH 23622248
MIRT916366 hsa-miR-141 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17347654, 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614142 28352 ENSG00000107874
Protein
UniProt ID Q9H467
Protein name CUE domain-containing protein 2
Protein function Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechani
Family and domains
Tissue specificity TISSUE SPECIFICITY: Significantly up-regulated in breast tumor tissues compared with matched adjacent normal tissues (at protein level). Levels inversely correlate with ESR1 in breast cancers and are lower in low-grade tumors compared to high-grade tumors
Sequence
MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEM
MEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEML
KEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQ
MLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEA
PKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH
Sequence length 287
Interactions View interactions
<