Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79004
Gene name Gene Name - the full gene name approved by the HGNC.	CUE domain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CUEDC2
Synonyms (NCBI Gene) Gene synonyms aliases	C10orf66, bA18I14.5
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q24.32

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045300	hsa-miR-186-5p	CLASH	23622248
MIRT043568	hsa-miR-331-3p	CLASH	23622248
MIRT043183	hsa-miR-324-5p	CLASH	23622248
MIRT039666	hsa-miR-615-3p	CLASH	23622248
MIRT916366	hsa-miR-141	CLIP-seq
MIRT916367	hsa-miR-154	CLIP-seq
MIRT916368	hsa-miR-200a	CLIP-seq
MIRT916369	hsa-miR-3123	CLIP-seq
MIRT916370	hsa-miR-3154	CLIP-seq
MIRT916371	hsa-miR-3179	CLIP-seq
MIRT916372	hsa-miR-3925-5p	CLIP-seq
MIRT916373	hsa-miR-4278	CLIP-seq
MIRT916374	hsa-miR-4433	CLIP-seq
MIRT916375	hsa-miR-4653-3p	CLIP-seq
MIRT916376	hsa-miR-4716-3p	CLIP-seq
MIRT916377	hsa-miR-4802-5p	CLIP-seq
MIRT916366	hsa-miR-141	CLIP-seq
MIRT916368	hsa-miR-200a	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17347654, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0010936	Process	Negative regulation of macrophage cytokine production	IEA
GO:0010936	Process	Negative regulation of macrophage cytokine production	IMP	24882011
GO:0031965	Component	Nuclear membrane	IDA
GO:0043130	Function	Ubiquitin binding	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IMP	24882011

MIM	HGNC	e!Ensembl
614142	28352	ENSG00000107874

Protein

UniProt ID

Q9H467

Protein name

CUE domain-containing protein 2

Protein function

Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechani

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Significantly up-regulated in breast tumor tissues compared with matched adjacent normal tissues (at protein level). Levels inversely correlate with ESR1 in breast cancers and are lower in low-grade tumors compared to high-grade tumors

Sequence

MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEM
MEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEML
KEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQ
MLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEA
PKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH

Sequence length

287

Interactions

View interactions

CUEDC2 (CUE domain containing 2)