Gene Gene information from NCBI Gene database.
Entrez ID 79004
Gene name CUE domain containing 2
Gene symbol CUEDC2
Synonyms (NCBI Gene)
C10orf66bA18I14.5
Chromosome 10
Chromosome location 10q24.32
miRNA miRNA information provided by mirtarbase database.
18
miRTarBase ID miRNA Experiments Reference
MIRT045300 hsa-miR-186-5p CLASH 23622248
MIRT043568 hsa-miR-331-3p CLASH 23622248
MIRT043183 hsa-miR-324-5p CLASH 23622248
MIRT039666 hsa-miR-615-3p CLASH 23622248
MIRT916366 hsa-miR-141 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17347654, 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614142 28352 ENSG00000107874
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H467
Protein name CUE domain-containing protein 2
Protein function Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechani
Family and domains
Tissue specificity TISSUE SPECIFICITY: Significantly up-regulated in breast tumor tissues compared with matched adjacent normal tissues (at protein level). Levels inversely correlate with ESR1 in breast cancers and are lower in low-grade tumors compared to high-grade tumors
Sequence
MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEM
MEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEML
KEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQ
MLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEA
PKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH
Sequence length 287
Interactions View interactions