GDAP1L1 (ganglioside induced differentiation associated protein 1 like 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
78997
Gene name Gene Name - the full gene name approved by the HGNC.
Ganglioside induced differentiation associated protein 1 like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GDAP1L1
Synonyms (NCBI Gene) Gene synonyms aliases
dJ881L22.1, dJ995J12.1.1
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.12
Summary Summary of gene provided in NCBI Entrez Gene.
The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein te
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(96)
miRTarBase ID miRNA Experiments Reference
MIRT668185 hsa-miR-411-5p HITS-CLIP 23824327
MIRT636510 hsa-miR-3183 HITS-CLIP 23824327
MIRT636509 hsa-miR-4723-3p HITS-CLIP 23824327
MIRT636508 hsa-miR-6769b-3p HITS-CLIP 23824327
MIRT636507 hsa-miR-3615 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96MZ0
Protein name Ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1-L1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13417 GST_N_3 49 → 126 Glutathione S-transferase, N-terminal domain Domain
PF13410 GST_C_2 179 → 304 Domain
Sequence 
MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQK
VRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVER
TFTGEHVVALMPEVGSLQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAE
IRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQ
IEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQS
FFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFAYW
YLKKKYI
Sequence length 367
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Show/Hide Text Mining Associations (3)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Dyskeratosis Congenita Associate 29696773
Mood Disorders Associate 29696773
Teratozoospermia Associate 25762640