Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
78987
Gene name Gene Name - the full gene name approved by the HGNC.
CRELD disulfide isomerase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CRELD1
Synonyms (NCBI Gene) Gene synonyms aliases
AVSD2, CIRRIN, JELANS
Disease Acronyms (UniProt) Disease acronyms from UniProt database
AVSD2, JELANS
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p25.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a subfamily of epidermal growth factor-related proteins. The encoded protein is characterized by a cysteine-rich with epidermal growth factor-like domain. This protein may function as a cell adhesion molecule. Mutations in th
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28941780 G>A Pathogenic, conflicting-interpretations-of-pathogenicity Non coding transcript variant, missense variant, coding sequence variant
rs28942091 C>G,T Likely-benign, risk-factor Non coding transcript variant, missense variant, coding sequence variant
rs28942092 C>T Uncertain-significance, risk-factor Non coding transcript variant, missense variant, coding sequence variant
rs121912626 C>G Risk-factor Non coding transcript variant, missense variant, coding sequence variant
rs121912627 G>A Risk-factor Non coding transcript variant, missense variant, coding sequence variant, 3 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004230 hsa-miR-346 Microarray 16822819
MIRT029353 hsa-miR-26b-5p Microarray 19088304
MIRT909472 hsa-miR-1200 CLIP-seq
MIRT909473 hsa-miR-1207-3p CLIP-seq
MIRT909474 hsa-miR-1207-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003197 Process Endocardial cushion development TAS 18076106
GO:0003279 Process Cardiac septum development TAS 18076106
GO:0003756 Function Protein disulfide isomerase activity IEA
GO:0005201 Function Extracellular matrix structural constituent RCA 28675934
GO:0005509 Function Calcium ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607170 14630 ENSG00000163703
Protein
UniProt ID Q96HD1
Protein name Protein disulfide isomerase CRELD1 (EC 5.3.4.1) (Cysteine-rich with EGF-like domain protein 1)
Protein function Protein disulfide isomerase (By similarity). Promotes the localization of acetylcholine receptors (AChRs) to the plasma membrane (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11938 DUF3456 45 103 TLR4 regulator and MIR-interacting MSAP Family
PF07645 EGF_CA 245 285 Calcium-binding EGF domain Domain
PF07645 EGF_CA 305 346 Calcium-binding EGF domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in fetal lung, liver, kidney, adult heart, brain and skeletal muscle. Weakly expressed in placenta, fetal brain, and adult lung, liver, kidney and pancreas. {ECO:0000269|PubMed:12137942}.
Sequence
MAPWPPKGLVPAMLWGLSLFLNLPGPIWLQPSPPPQSSPPPQPHPCHTCRGLVDSFNKGL
ERTIRDNFGGGNTAWEEENLSKYKDSETRLVEVLEGVCSKSDF
ECHRLLELSEELVESWW
FHKQQEAPDLFQWLCSDSLKLCCPAGTFGPSCLPCPGGTERPCGGYGQCEGEGTRGGSGH
CDCQAGYGGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESNCLQCKKGWALHH
LKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVG
SKCLDVDECETEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
DELVVLQQMFFGIIICALATLAAKGDLVFTAIFIGAVAAMTGYWLSERSDRVLEGFIKGR
Sequence length 420
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Bicuspid aortic valve Bicuspid aortic valve rs1569484234, rs1569484208
Dextrocardia Dextrocardia rs1555672928
Double outlet right ventricle Double Outlet Right Ventricle rs397514520, rs397514521
Heterotaxia Heterotaxy Syndrome rs200321595, rs775946081, rs1060501464, rs1560086701
Unknown
Disease term Disease name Evidence References Source
Atrioventricular septal defect atrioventricular septal defect, susceptibility to, 2 GenCC
Congenital Heart Disease congenital heart disease GenCC
Neurodevelopmental Disorders complex neurodevelopmental disorder GenCC
Associations from Text Mining
Disease Name Relationship Type References
Atrioventricular Septal Defect Associate 23040494
Autistic Disorder Associate 37322441
Bicuspid Aortic Valve Disease Associate 36929416
Double Outlet Right Ventricle Associate 37322441
Down Syndrome Associate 23040494
Heart Defects Congenital Associate 29952356, 36929416
Turner Syndrome Associate 36929416