Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7884
Gene name Gene Name - the full gene name approved by the HGNC.
Stem-loop histone mRNA binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLBP
Synonyms (NCBI Gene) Gene synonyms aliases
HBP
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p16.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023573 hsa-miR-1-3p Microarray 18668037
MIRT029110 hsa-miR-26b-5p Microarray 19088304
MIRT609764 hsa-miR-8485 HITS-CLIP 23824327
MIRT609763 hsa-miR-329-3p HITS-CLIP 23824327
MIRT609762 hsa-miR-362-3p HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
UPF1 Unknown 25016523
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002191 Process Cap-dependent translational initiation IDA 18025107
GO:0003723 Function RNA binding HDA 22658674
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IBA
GO:0003729 Function MRNA binding IDA 16912046
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602422 10904 ENSG00000163950
Protein
UniProt ID Q14493
Protein name Histone RNA hairpin-binding protein (Histone stem-loop-binding protein)
Protein function RNA-binding protein involved in the histone pre-mRNA processing (PubMed:12588979, PubMed:19155325, PubMed:8957003, PubMed:9049306). Binds the stem-loop structure of replication-dependent histone pre-mRNAs and contributes to efficient 3'-end proc
PDB 2KJM , 4L8R , 4QOZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15247 SLBP_RNA_bind 130 199 Histone RNA hairpin-binding protein RNA-binding domain Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9049306}.
Sequence
MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAERRPESF
TTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKES
MSTVPADFETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSR
RSWDQQIKLWKVALHFWDP
PAEEGCDLQEIHPVDLESAESSSEPQTSSQDDFDVYSGTPT
KVRHMDSQVEDEFDLEACLTEPLRDFSAMS
Sequence length 270
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Transport of the SLBP Dependant Mature mRNA
RNA Polymerase II Transcription Termination
SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs
<