Gene Gene information from NCBI Gene database.
Entrez ID 7884
Gene name Stem-loop histone mRNA binding protein
Gene symbol SLBP
Synonyms (NCBI Gene)
HBP
Chromosome 4
Chromosome location 4p16.3
Summary This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential
miRNA miRNA information provided by mirtarbase database.
226
miRTarBase ID miRNA Experiments Reference
MIRT023573 hsa-miR-1-3p Microarray 18668037
MIRT029110 hsa-miR-26b-5p Microarray 19088304
MIRT609764 hsa-miR-8485 HITS-CLIP 23824327
MIRT609763 hsa-miR-329-3p HITS-CLIP 23824327
MIRT609762 hsa-miR-362-3p HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
UPF1 Unknown 25016523
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0002191 Process Cap-dependent translational initiation IDA 18025107
GO:0003723 Function RNA binding HDA 22658674
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IBA
GO:0003729 Function MRNA binding IDA 16912046
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602422 10904 ENSG00000163950
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14493
Protein name Histone RNA hairpin-binding protein (Histone stem-loop-binding protein)
Protein function RNA-binding protein involved in the histone pre-mRNA processing (PubMed:12588979, PubMed:19155325, PubMed:8957003, PubMed:9049306). Binds the stem-loop structure of replication-dependent histone pre-mRNAs and contributes to efficient 3'-end proc
PDB 2KJM , 4L8R , 4QOZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15247 SLBP_RNA_bind 130 199 Histone RNA hairpin-binding protein RNA-binding domain Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9049306}.
Sequence
MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAERRPESF
TTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKES
MSTVPADFETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSR
RSWDQQIKLWKVALHFWDP
PAEEGCDLQEIHPVDLESAESSSEPQTSSQDDFDVYSGTPT
KVRHMDSQVEDEFDLEACLTEPLRDFSAMS
Sequence length 270
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Transport of the SLBP Dependant Mature mRNA
RNA Polymerase II Transcription Termination
SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs