Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7869
Gene name Gene Name - the full gene name approved by the HGNC.	Semaphorin 3B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SEMA3B
Synonyms (NCBI Gene) Gene synonyms aliases	LUCA-1, SEMA5, SEMAA, SemA, semaV
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the class-3 semaphorin/collapsin family, whose members function in growth cone guidance during neuronal development. This family member inhibits axonal extension and has been shown to act as a tumor suppressor b

Show/Hide all(23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016807	hsa-miR-335-5p	Microarray	18185580
MIRT1334623	hsa-miR-1178	CLIP-seq
MIRT1334624	hsa-miR-150	CLIP-seq
MIRT1334625	hsa-miR-1915	CLIP-seq
MIRT1334626	hsa-miR-3120-5p	CLIP-seq
MIRT1334627	hsa-miR-3160-5p	CLIP-seq
MIRT1334628	hsa-miR-3173-3p	CLIP-seq
MIRT1334629	hsa-miR-3689d	CLIP-seq
MIRT1334630	hsa-miR-4713-5p	CLIP-seq
MIRT1334631	hsa-miR-4726-3p	CLIP-seq
MIRT1334632	hsa-miR-532-3p	CLIP-seq
MIRT1334633	hsa-miR-541	CLIP-seq
MIRT1334634	hsa-miR-544	CLIP-seq
MIRT1334635	hsa-miR-615-5p	CLIP-seq
MIRT1334636	hsa-miR-654-5p	CLIP-seq
MIRT1334637	hsa-miR-767-3p	CLIP-seq
MIRT2098985	hsa-miR-1247	CLIP-seq
MIRT1334626	hsa-miR-3120-5p	CLIP-seq
MIRT2098986	hsa-miR-3194-3p	CLIP-seq
MIRT2098987	hsa-miR-4633-3p	CLIP-seq
MIRT2098988	hsa-miR-4638-5p	CLIP-seq
MIRT2098989	hsa-miR-516b	CLIP-seq
MIRT1334637	hsa-miR-767-3p	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001755	Process	Neural crest cell migration	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	8633026
GO:0005886	Component	Plasma membrane	IBA
GO:0007267	Process	Cell-cell signaling	TAS	8633026
GO:0007411	Process	Axon guidance	IBA
GO:0007411	Process	Axon guidance	TAS	8633026
GO:0030215	Function	Semaphorin receptor binding	IBA
GO:0030215	Function	Semaphorin receptor binding	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0038191	Function	Neuropilin binding	IBA
GO:0045499	Function	Chemorepellent activity	IBA
GO:0045499	Function	Chemorepellent activity	TAS	22998873
GO:0050919	Process	Negative chemotaxis	IBA
GO:0061643	Process	Chemorepulsion of axon	TAS	22998873
GO:0071526	Process	Semaphorin-plexin signaling pathway	IBA

MIM	HGNC	e!Ensembl
601281	10724	ENSG00000012171

Protein

UniProt ID

Q13214

Protein name

Semaphorin-3B (Sema A(V)) (Semaphorin-V) (Sema V)

Protein function

Inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01403	Sema	57 → 495	Sema domain	Family
PF00047	ig	577 → 657	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed abundantly but differentially in a variety of neural and nonneural tissues.

Sequence

MGRAGAAAVIPGLALLWAVGLGSAAPSPPRLRLSFQELQAWHGLQTFSLERTCCYQALLV
DEERGRLFVGAENHVASLNLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLL
HAYNRTHLLACGTGAFHPTCAFVEVGHRAEEPVLRLDPGRIEDGKGKSPYDPRHRAASVL
VGEELYSGVAADLMGRDFTIFRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDD
KIYFFFRETAVEAAPALGRLSVSRVGQICRNDVGGQRSLVNKWTTFLKARLVCSVPGVEG
DTHFDQLQDVFLLSSRDHRTPLLYAVFSTSSSIFQGSAVCVYSMNDVRRAFLGPFAHKEG
PMHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLPTGGRPL
FLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELH
VFEDSAAVTSMQISSKRHQLYVASRSAVAQIALHRCAAHGRVCTECCLARDPYCAWDGVA
CTRFQPSAKRRFRRQDVRNGDPSTLCSGDSSRPALLEHKVFGVEGSSAFLECEPRSLQAR
VEWTFQRAGVTAHTQVLAEERTERTARGLLLRRLRRRDSGVYLCAAVEQGFTQPLRRLSL
HVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPALQSLP
LESRRKGRNRRTHAPEPRAERGPRSATHW

Sequence length

749

Interactions

View interactions

	KEGG
	Axon guidance

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Insomnia	Insomnia	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (25)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arthritis Rheumatoid	Inhibit	38283352
Breast Neoplasms	Inhibit	18922901, 36123344
Breast Neoplasms	Associate	32867770, 35990656
Calcinosis Cutis	Stimulate	18458115
Carcinogenesis	Associate	31217417
Carcinoma Hepatocellular	Associate	20532728
Carcinoma Non Small Cell Lung	Associate	20521346
Carcinoma Ovarian Epithelial	Associate	39519394
Endometrial Neoplasms	Inhibit	21933904
Endometrial Neoplasms	Associate	31217417
Glioblastoma	Associate	35287551
Glioma	Associate	26197878, 27050958
Hippocampal Sclerosis	Associate	32189710
Idiopathic Pulmonary Fibrosis	Associate	37858084
Inflammation	Inhibit	38283352
Leukemia Myeloid Acute	Stimulate	24280143
Lung Neoplasms	Associate	18793406
Neoplasm Metastasis	Associate	21933904, 39519394
Neoplasms	Associate	11922394, 18781179, 21933904, 24553122, 25016954, 31217417, 35287551, 39519394
Neoplasms	Inhibit	18458115, 18793406, 18922901
Neuroma Acoustic	Associate	23354516
Ovarian Neoplasms	Associate	20124444
Peritonitis	Associate	39519394
Persistent Fetal Circulation Syndrome	Associate	34315444
Stomach Neoplasms	Associate	35287551

SEMA3B (semaphorin 3B)