Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7850
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 1 receptor type 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL1R2
Synonyms (NCBI Gene) Gene synonyms aliases
CD121b, CDw121b, IL-1R-2, IL-1RT-2, IL-1RT2, IL1R2c, IL1RB
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029779 hsa-miR-26b-5p Microarray 19088304
Transcription factors
Transcription factor Regulation Reference
GLI1 Unknown 16880536
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004908 Function Interleukin-1 receptor activity IBA
GO:0004908 Function Interleukin-1 receptor activity IEA
GO:0004908 Function Interleukin-1 receptor activity TAS 10191101
GO:0004910 Function Interleukin-1, type II, blocking receptor activity IEA
GO:0005515 Function Protein binding IPI 1830582, 16971486, 25241761
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
147811 5994 ENSG00000115590
Protein
UniProt ID P27930
Protein name Interleukin-1 receptor type 2 (IL-1R-2) (IL-1RT-2) (IL-1RT2) (CD121 antigen-like family member B) (CDw121b) (IL-1 type II receptor) (Interleukin-1 receptor beta) (IL-1R-beta) (Interleukin-1 receptor type II) (CD antigen CD121b) [Cleaved into: Interleukin-
Protein function Non-signaling receptor for IL1A, IL1B and IL1RN. Reduces IL1B activities. Serves as a decoy receptor by competitive binding to IL1B and preventing its binding to IL1R1. Also modulates cellular response through non-signaling association with IL1R
PDB 3O4O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18452 Ig_6 82 131 Immunoglobulin domain Domain
PF00047 ig 241 341 Immunoglobulin domain Domain
Sequence
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
IELRVFENTDA
FLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTV
KEASSTFSWGIVLAPLSLA
FLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK
Sequence length 398
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Hematopoietic cell lineage
Amoebiasis
Human T-cell leukemia virus 1 infection
Transcriptional misregulation in cancer
Prostate cancer
Fluid shear stress and atherosclerosis
  Interleukin-10 signaling
Interleukin-1 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ankylosing Spondylitis Ankylosing spondylitis N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease (MTAG) N/A N/A GWAS
Ulcerative colitis Ulcerative colitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 31635541
Adenocarcinoma of Lung Associate 39838222
Age Related Hearing Impairment 1 Associate 32252823
Anxiety Associate 25249351
Arthritis Rheumatoid Associate 33507149
ATR X syndrome Associate 32727543
Breast Neoplasms Associate 24411993
Carcinogenesis Associate 30460760
Carcinoma Pancreatic Ductal Associate 20808857, 35395492
Cardiotoxicity Associate 37750583