Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
785
Gene name Gene Name - the full gene name approved by the HGNC.
Calcium voltage-gated channel auxiliary subunit beta 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CACNB4
Synonyms (NCBI Gene) Gene synonyms aliases
CAB4, CACNLB4, EA5, EIG9, EJM, EJM4, EJM6
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, b
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1805031 C>A Pathogenic, uncertain-significance, conflicting-interpretations-of-pathogenicity, risk-factor 5 prime UTR variant, coding sequence variant, missense variant, non coding transcript variant
rs1805032 G>A Risk-factor Stop gained, coding sequence variant, genic downstream transcript variant, non coding transcript variant
rs200092211 G>A Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity Non coding transcript variant, upstream transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs200662010 G>C Likely-benign, conflicting-interpretations-of-pathogenicity, uncertain-significance Non coding transcript variant, upstream transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs542973906 G>A Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance Genic upstream transcript variant, non coding transcript variant, coding sequence variant, upstream transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030091 hsa-miR-26b-5p Sequencing 20371350
MIRT739410 hsa-miR-4802-3p HITS-CLIP 33718276
MIRT857912 hsa-miR-103a CLIP-seq
MIRT857913 hsa-miR-107 CLIP-seq
MIRT857914 hsa-miR-1183 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005245 Function Voltage-gated calcium channel activity IDA 16525042
GO:0005245 Function Voltage-gated calcium channel activity IEA
GO:0005246 Function Calcium channel regulator activity IDA 11880487
GO:0005262 Function Calcium channel activity IEA
GO:0005515 Function Protein binding IPI 16525042, 25910212, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601949 1404 ENSG00000182389
Protein
UniProt ID O00305
Protein name Voltage-dependent L-type calcium channel subunit beta-4 (CAB4) (Calcium channel voltage-dependent subunit beta 4)
Protein function The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and c
PDB 2D46
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12052 VGCC_beta4Aa_N 50 91 Voltage gated calcium channel subunit beta domain 4Aa N terminal Domain
PF00625 Guanylate_kin 218 398 Guanylate kinase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in the cerebellum and kidney.
Sequence
MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQGSADSYTSRPS
DSDVSLEEDREAIRQEREQQAAIQLERAKSK
PVAFAVKTNVSYCGALDEDVPVPSTAISF
DAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGGKSSGNS
SSSLGEMVSGTFRATPTSTAKQKQKVTEHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQK
ALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRSSLAEVQSEIERIF
ELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQ
LVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAY
WRATHTTSSTPMTPLLGRNLGS
TALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQH
SRDHYPLVEEDYPDSYQDTYKPHRNRGSPGGYSHDSRHRL
Sequence length 520
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy
  Presynaptic depolarization and calcium channel opening
Phase 0 - rapid depolarisation
Phase 2 - plateau phase
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Epilepsy Epilepsy, idiopathic generalized, susceptibility to, 9 rs1057518688 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Astrocytoma Pilocytic astrocytoma N/A N/A GWAS
Episodic ataxia episodic ataxia type 5 N/A N/A ClinVar
Myoclonic Epilepsy juvenile myoclonic epilepsy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alopecia Associate 24025145
Cerebellar Diseases Associate 35256372
Drug Resistant Epilepsy Associate 28388656
Epilepsy Associate 31056551, 35256372
Epilepsy Absence Associate 20561025
Epilepsy Familial Mesial Temporal Lobe Associate 34086756
Epilepsy Temporal Lobe Associate 35256372
Episodic Ataxia Associate 29062094
Schizophrenia Associate 28359200