Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7849
Gene name Gene Name - the full gene name approved by the HGNC.	Paired box 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PAX8
Synonyms (NCBI Gene) Gene synonyms aliases	PAX-8
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in

Show/Hide all(131)

miRTarBase ID	miRNA	Experiments	Reference
MIRT513402	hsa-miR-3200-5p	PAR-CLIP	23446348
MIRT513401	hsa-miR-199a-5p	PAR-CLIP	23446348
MIRT513400	hsa-miR-199b-5p	PAR-CLIP	23446348
MIRT513399	hsa-miR-345-5p	PAR-CLIP	23446348
MIRT513398	hsa-miR-8068	PAR-CLIP	23446348
MIRT450435	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT450434	hsa-miR-1252-5p	PAR-CLIP	22100165
MIRT450433	hsa-miR-1180-5p	PAR-CLIP	22100165
MIRT450432	hsa-miR-7114-3p	PAR-CLIP	22100165
MIRT513402	hsa-miR-3200-5p	PAR-CLIP	23446348
MIRT513401	hsa-miR-199a-5p	PAR-CLIP	23446348
MIRT513400	hsa-miR-199b-5p	PAR-CLIP	23446348
MIRT513399	hsa-miR-345-5p	PAR-CLIP	23446348
MIRT513398	hsa-miR-8068	PAR-CLIP	23446348
MIRT450435	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT450434	hsa-miR-1252-5p	PAR-CLIP	22100165
MIRT450433	hsa-miR-1180-5p	PAR-CLIP	22100165
MIRT450432	hsa-miR-7114-3p	PAR-CLIP	22100165
MIRT1215470	hsa-miR-1233	CLIP-seq
MIRT1215471	hsa-miR-1238	CLIP-seq
MIRT1215472	hsa-miR-1321	CLIP-seq
MIRT1215473	hsa-miR-1343	CLIP-seq
MIRT1215474	hsa-miR-1976	CLIP-seq
MIRT1215475	hsa-miR-2117	CLIP-seq
MIRT1215476	hsa-miR-23a	CLIP-seq
MIRT1215477	hsa-miR-23b	CLIP-seq
MIRT1215478	hsa-miR-23c	CLIP-seq
MIRT1215479	hsa-miR-3074-5p	CLIP-seq
MIRT1215480	hsa-miR-3124-3p	CLIP-seq
MIRT1215481	hsa-miR-3162-5p	CLIP-seq
MIRT1215482	hsa-miR-3199	CLIP-seq
MIRT1215483	hsa-miR-330-3p	CLIP-seq
MIRT1215484	hsa-miR-33a	CLIP-seq
MIRT1215485	hsa-miR-33b	CLIP-seq
MIRT1215486	hsa-miR-3622b-5p	CLIP-seq
MIRT1215487	hsa-miR-380	CLIP-seq
MIRT1215488	hsa-miR-4257	CLIP-seq
MIRT1215489	hsa-miR-4291	CLIP-seq
MIRT1215490	hsa-miR-4292	CLIP-seq
MIRT1215491	hsa-miR-4308	CLIP-seq
MIRT1215492	hsa-miR-4310	CLIP-seq
MIRT1215493	hsa-miR-4328	CLIP-seq
MIRT1215494	hsa-miR-4446-5p	CLIP-seq
MIRT1215495	hsa-miR-4495	CLIP-seq
MIRT1215496	hsa-miR-4659a-3p	CLIP-seq
MIRT1215497	hsa-miR-4659b-3p	CLIP-seq
MIRT1215498	hsa-miR-4687-5p	CLIP-seq
MIRT1215499	hsa-miR-4713-3p	CLIP-seq
MIRT1215500	hsa-miR-4731-3p	CLIP-seq
MIRT1215501	hsa-miR-4739	CLIP-seq
MIRT1215502	hsa-miR-4753-3p	CLIP-seq
MIRT1215503	hsa-miR-4755-5p	CLIP-seq
MIRT1215504	hsa-miR-4756-5p	CLIP-seq
MIRT1215505	hsa-miR-4778-3p	CLIP-seq
MIRT1215506	hsa-miR-4801	CLIP-seq
MIRT1215507	hsa-miR-511	CLIP-seq
MIRT1215508	hsa-miR-607	CLIP-seq
MIRT1215509	hsa-miR-670	CLIP-seq
MIRT1215470	hsa-miR-1233	CLIP-seq
MIRT1215472	hsa-miR-1321	CLIP-seq
MIRT1215481	hsa-miR-3162-5p	CLIP-seq
MIRT1215488	hsa-miR-4257	CLIP-seq
MIRT1215498	hsa-miR-4687-5p	CLIP-seq
MIRT1215499	hsa-miR-4713-3p	CLIP-seq
MIRT1215501	hsa-miR-4739	CLIP-seq
MIRT1215504	hsa-miR-4756-5p	CLIP-seq
MIRT2062000	hsa-miR-1207-5p	CLIP-seq
MIRT2062001	hsa-miR-1293	CLIP-seq
MIRT2062002	hsa-miR-1305	CLIP-seq
MIRT1215472	hsa-miR-1321	CLIP-seq
MIRT2062003	hsa-miR-28-5p	CLIP-seq
MIRT2062004	hsa-miR-3139	CLIP-seq
MIRT1215483	hsa-miR-330-3p	CLIP-seq
MIRT2062005	hsa-miR-3679-3p	CLIP-seq
MIRT1215490	hsa-miR-4292	CLIP-seq
MIRT1215491	hsa-miR-4308	CLIP-seq
MIRT2062006	hsa-miR-4459	CLIP-seq
MIRT2062007	hsa-miR-4476	CLIP-seq
MIRT2062008	hsa-miR-4483	CLIP-seq
MIRT2062009	hsa-miR-4505	CLIP-seq
MIRT1215496	hsa-miR-4659a-3p	CLIP-seq
MIRT1215497	hsa-miR-4659b-3p	CLIP-seq
MIRT2062010	hsa-miR-4667-5p	CLIP-seq
MIRT2062011	hsa-miR-4700-5p	CLIP-seq
MIRT2062012	hsa-miR-4722-5p	CLIP-seq
MIRT2062013	hsa-miR-4731-5p	CLIP-seq
MIRT2062014	hsa-miR-4736	CLIP-seq
MIRT1215501	hsa-miR-4739	CLIP-seq
MIRT1215504	hsa-miR-4756-5p	CLIP-seq
MIRT2062015	hsa-miR-4763-3p	CLIP-seq
MIRT2062016	hsa-miR-4779	CLIP-seq
MIRT1215508	hsa-miR-607	CLIP-seq
MIRT2062017	hsa-miR-637	CLIP-seq
MIRT2062018	hsa-miR-665	CLIP-seq
MIRT2062019	hsa-miR-708	CLIP-seq
MIRT2062020	hsa-miR-873	CLIP-seq
MIRT1215470	hsa-miR-1233	CLIP-seq
MIRT1215472	hsa-miR-1321	CLIP-seq
MIRT2290498	hsa-miR-1913	CLIP-seq
MIRT2290499	hsa-miR-3126-5p	CLIP-seq
MIRT1215481	hsa-miR-3162-5p	CLIP-seq
MIRT2290500	hsa-miR-324-3p	CLIP-seq
MIRT2290501	hsa-miR-3689d	CLIP-seq
MIRT2290502	hsa-miR-3929	CLIP-seq
MIRT2290503	hsa-miR-4419a	CLIP-seq
MIRT2290504	hsa-miR-4419b	CLIP-seq
MIRT2290505	hsa-miR-4478	CLIP-seq
MIRT2290506	hsa-miR-4510	CLIP-seq
MIRT1215498	hsa-miR-4687-5p	CLIP-seq
MIRT1215499	hsa-miR-4713-3p	CLIP-seq
MIRT1215501	hsa-miR-4739	CLIP-seq
MIRT1215504	hsa-miR-4756-5p	CLIP-seq
MIRT2290507	hsa-miR-485-5p	CLIP-seq
MIRT2392172	hsa-miR-4287	CLIP-seq
MIRT2392173	hsa-miR-4469	CLIP-seq
MIRT2062010	hsa-miR-4667-5p	CLIP-seq
MIRT2392174	hsa-miR-4685-3p	CLIP-seq
MIRT2062011	hsa-miR-4700-5p	CLIP-seq
MIRT2392175	hsa-miR-4768-5p	CLIP-seq
MIRT2392176	hsa-miR-491-3p	CLIP-seq
MIRT2392177	hsa-miR-942	CLIP-seq
MIRT2588517	hsa-miR-1182	CLIP-seq
MIRT2588518	hsa-miR-219-1-3p	CLIP-seq
MIRT2588519	hsa-miR-323b-5p	CLIP-seq
MIRT2588520	hsa-miR-3978	CLIP-seq
MIRT2588521	hsa-miR-571	CLIP-seq
MIRT2588517	hsa-miR-1182	CLIP-seq
MIRT2588518	hsa-miR-219-1-3p	CLIP-seq
MIRT2588519	hsa-miR-323b-5p	CLIP-seq
MIRT2588520	hsa-miR-3978	CLIP-seq
MIRT2588521	hsa-miR-571	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
EZH2	Unknown	21289264

Show/Hide all(86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	15356023
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	9388203
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001655	Process	Urogenital system development	IEA
GO:0001655	Process	Urogenital system development	ISS
GO:0001656	Process	Metanephros development	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEP	1337742
GO:0001822	Process	Kidney development	IEP	15494458
GO:0001823	Process	Mesonephros development	IEA
GO:0001823	Process	Mesonephros development	ISS
GO:0003281	Process	Ventricular septum development	IEA
GO:0003337	Process	Mesenchymal to epithelial transition involved in metanephros morphogenesis	IEP	8861958
GO:0003677	Function	DNA binding	IDA	8861958, 15961562
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	9590296
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9388203, 9590296
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10377248
GO:0004996	Function	Thyroid-stimulating hormone receptor activity	TAS	9590296
GO:0005515	Function	Protein binding	IPI	19010321, 20195357, 32296183
GO:0005634	Component	Nucleus	IDA	9388203, 15961562, 21317881
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	ISS
GO:0006351	Process	DNA-templated transcription	IDA	9590296
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007399	Process	Nervous system development	IBA
GO:0007417	Process	Central nervous system development	IEA
GO:0007417	Process	Central nervous system development	IEP	15494458
GO:0007423	Process	Sensory organ development	IBA
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9590296
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030878	Process	Thyroid gland development	IEA
GO:0030878	Process	Thyroid gland development	IEP	1337742, 15494458
GO:0030878	Process	Thyroid gland development	IMP	9590296
GO:0038194	Process	Thyroid-stimulating hormone signaling pathway	IEA
GO:0039003	Process	Pronephric field specification	IEA
GO:0039003	Process	Pronephric field specification	ISS
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042472	Process	Inner ear morphogenesis	ISS
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	8413205, 8861958, 9388203, 15356023, 15961562
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9388203
GO:0048793	Process	Pronephros development	IEA
GO:0048793	Process	Pronephros development	ISS
GO:0071371	Process	Cellular response to gonadotropin stimulus	IDA	15961562
GO:0071599	Process	Otic vesicle development	IEP	15494458
GO:0072050	Process	S-shaped body morphogenesis	IEA
GO:0072073	Process	Kidney epithelium development	IEA
GO:0072108	Process	Positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	IEA
GO:0072108	Process	Positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	ISS
GO:0072164	Process	Mesonephric tubule development	IEA
GO:0072207	Process	Metanephric epithelium development	IEP	7856737
GO:0072221	Process	Metanephric distal convoluted tubule development	IEA
GO:0072221	Process	Metanephric distal convoluted tubule development	ISS
GO:0072278	Process	Metanephric comma-shaped body morphogenesis	IEP	1337742
GO:0072284	Process	Metanephric S-shaped body morphogenesis	IEP	1337742
GO:0072289	Process	Metanephric nephron tubule formation	IEA
GO:0072289	Process	Metanephric nephron tubule formation	ISS
GO:0072305	Process	Negative regulation of mesenchymal cell apoptotic process involved in metanephric nephron morphogenesis	IEA
GO:0072305	Process	Negative regulation of mesenchymal cell apoptotic process involved in metanephric nephron morphogenesis	ISS
GO:0072307	Process	Regulation of metanephric nephron tubule epithelial cell differentiation	IEA
GO:0072307	Process	Regulation of metanephric nephron tubule epithelial cell differentiation	ISS
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	ISS
GO:1900212	Process	Negative regulation of mesenchymal cell apoptotic process involved in metanephros development	IEA
GO:1900212	Process	Negative regulation of mesenchymal cell apoptotic process involved in metanephros development	ISS
GO:1900215	Process	Negative regulation of apoptotic process involved in metanephric collecting duct development	IEA
GO:1900215	Process	Negative regulation of apoptotic process involved in metanephric collecting duct development	ISS
GO:1900218	Process	Negative regulation of apoptotic process involved in metanephric nephron tubule development	IEA
GO:1900218	Process	Negative regulation of apoptotic process involved in metanephric nephron tubule development	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000594	Process	Positive regulation of metanephric DCT cell differentiation	IEA
GO:2000594	Process	Positive regulation of metanephric DCT cell differentiation	ISS
GO:2000611	Process	Positive regulation of thyroid hormone generation	IEA
GO:2000611	Process	Positive regulation of thyroid hormone generation	IMP	15356023
GO:2000612	Process	Regulation of thyroid-stimulating hormone secretion	IMP	15356023

MIM	HGNC	e!Ensembl
167415	8622	ENSG00000125618

Protein

UniProt ID

Q06710

Protein name

Paired box protein Pax-8

Protein function

Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.

PDB

2K27

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00292	PAX	9 → 133		Domain
PF12403	Pax2_C	337 → 449	Paired-box protein 2 C terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the excretory system, thyroid gland and Wilms tumors.

Sequence

MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF
ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD
PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQAL
LSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP
NSSLLSSPYYYSSTSRPSAPPTTATAFDHL

Sequence length

450

Interactions

View interactions

	KEGG
	Thyroid hormone synthesis Pathways in cancer Transcriptional misregulation in cancer Thyroid cancer

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Hypothyroidism	Hypothyroidism, congenital, nongoitrous, 2	rs121917719, rs104893660, rs104893655, rs104893657, rs104893658, rs104893659, rs104893656	N/A

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Cervical Cancer	Cervical cancer	N/A	N/A	GWAS
Congenital Hypothyroidism	congenital hypothyroidism	N/A	N/A	ClinVar
Insomnia	Insomnia	N/A	N/A	GWAS
Kidney Disease	Chronic kidney disease	N/A	N/A	GWAS
Thyroid Hypoplasia	thyroid hypoplasia	N/A	N/A	GenCC

Show/Hide Text Mining Associations (114)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	26910219
Adenocarcinoma Follicular	Associate	15238980, 15256783, 15972966, 20056739, 21317881, 23025542, 24510380, 24798894, 26649796, 29108474, 30210064
Adenocarcinoma in Situ	Associate	26910219
Adenocarcinoma Mucinous	Associate	26797858, 30258209, 34103667, 35405716
Adenoma	Associate	15238980, 21317881, 23025542, 29108474, 30648929, 31273314
Adenoma Oxyphilic	Associate	19525927, 23194047
Adenoma Pleomorphic	Associate	24771139
Anemia Sickle Cell	Associate	35321643
Atherosclerosis	Associate	36658621
Atypical Squamous Cells of the Cervix	Associate	29469940
Bantu siderosis	Associate	18840782
Blast Injuries	Stimulate	31621494
Bohring syndrome	Associate	33121525
Breast Neoplasms	Associate	21328566, 34972751
Calcinosis Cutis	Associate	19525927, 21317881
Cancer Familial with In Vitro Radioresistance	Inhibit	28621618
Carcinogenesis	Associate	31821746
Carcinoid Tumor	Associate	35750423
Carcinoma	Associate	18084247, 19525927, 26350056, 28069049, 30210064, 30723294
Carcinoma Adenosquamous	Associate	30258209
Carcinoma Hepatocellular	Associate	28339471, 31915309, 32638211
Carcinoma Medullary	Associate	19525927
Carcinoma Neuroendocrine	Associate	21328566
Carcinoma Non Small Cell Lung	Associate	19139719
Carcinoma Ovarian Epithelial	Associate	28103614, 31050342, 38012622
Carcinoma Papillary	Associate	24798894
Carcinoma Papillary Follicular	Associate	29108474
Carcinoma Renal Cell	Associate	18084247, 19525927, 20463571, 20679884, 21317881, 22495365, 23194047, 24618616, 24625422, 25315900, 26527083, 28449664, 31431624, 32847623, 33850477 View all (5 more)
Carcinoma Small Cell	Associate	21317881, 26350056
Carcinoma Squamous Cell	Associate	30210064, 32847623
Carcinoma Squamous Cell	Stimulate	33649031
Carcinoma Transitional Cell	Associate	30059451
Colorectal Neoplasms	Associate	26075790, 35979157
Congenital Hypothyroidism	Associate	10377248, 25146893, 27207603, 28060725, 33434492, 34234053, 35611983, 36614229, 40362701
Cystadenoma Serous	Associate	37098593
Cysts	Associate	29197096
Desmoplastic Small Round Cell Tumor	Associate	26350056
Diabetes Mellitus Type 2	Associate	18840782
Endodermal Sinus Tumor	Associate	22495365, 31375771
Endometrial Neoplasms	Associate	22644304, 36281161, 40138919
Endometrial Neoplasms	Inhibit	26132201
Endometrial Neoplasms	Stimulate	32847623
Endometrial Stromal Tumors	Associate	30340515
Endometriosis	Associate	17140576, 35387670
Epileptic Syndromes	Associate	27373559
Florid cystic endosalpingiosis of the uterus	Associate	17140576
Follicular Cyst	Associate	30210064
Gastrointestinal Neoplasms	Associate	31239549
Glioblastoma	Associate	24602166
Gliosarcoma	Associate	38358216
Glycosuria Renal	Associate	19525927, 26350056
Granular Cell Tumor	Associate	34925233
Granulosa cell tumor of the ovary	Associate	34925233
Hemangioblastoma	Associate	25973115, 36510186
Hemolysis	Associate	35321643
Hereditary Breast and Ovarian Cancer Syndrome	Associate	24220311
Hereditary renal agenesis	Associate	26617871
Hypothyroidism	Associate	25146893, 29650690, 36593237
Hypothyroidism Congenital Nongoitrous 2	Associate	20976176, 25146893, 26617871, 32765423
Idiopathic Pulmonary Fibrosis	Associate	30720061
Kidney Neoplasms	Associate	19525927, 23194047, 25315900, 27910947, 35676472, 37938323
Leukemia Lymphocytic Chronic B Cell	Associate	37077094
Lung Neoplasms	Associate	30024911
Lymphoma	Associate	21317881, 22037256
Lymphoma Non Hodgkin	Associate	30059451
Malaria	Associate	35321643
Mammary Analogue Secretory Carcinoma	Associate	27282352
Mental Disorders	Associate	29362489
Mesothelioma Malignant	Associate	32429658
Mixed Tumor Mullerian	Associate	21317881, 24771139
Mullerian aplasia	Associate	20949455, 21317881, 33434492, 35361250
Neoplasm Invasiveness	Associate	19238079
Neoplasm Metastasis	Associate	24771139, 34108011
Neoplasms	Associate	18616821, 19893615, 20526288, 20564403, 20971497, 21317881, 23436219, 24602166, 24625422, 24771139, 26197800, 26337721, 26350056, 26797858, 27283500 View all (31 more)
Neoplasms	Stimulate	22644304
Neoplasms Cystic Mucinous and Serous	Associate	23368871, 35405716
Neoplasms Glandular and Epithelial	Associate	18084247, 20731005, 26910219
Neoplasms Squamous Cell	Associate	18616821
Neuroectodermal Tumors Primitive	Associate	26350056
Neuroendocrine Tumors	Associate	20890270, 21328566
Nonsyndromic Holoprosencephaly	Associate	27494611
Ovarian Cysts	Associate	18084247, 32847623
Ovarian Diseases	Associate	23529305
Ovarian Neoplasms	Associate	12960427, 18084247, 19238079, 20132413, 20572292, 21746896, 22705448, 23368871, 23529305, 24342438, 25473747, 26079312, 27259239, 28103614, 30024911 View all (7 more)
Pancreatic Neoplasms	Associate	20890270
Pancreatic Neoplasms	Stimulate	21328566
Pancreatitis	Associate	21328566
Peritoneal Neoplasms	Associate	33399341
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	14531904
Protoporphyria Erythropoietic	Stimulate	40138919
Rectal Diseases	Stimulate	20890270
Reproductive Tract Infections	Associate	32847623
Salivary Gland Neoplasms	Associate	24771139
Sarcoma Ewing	Associate	26350056
Seminoma	Associate	18084247, 22495365
Sleep Wake Disorders	Associate	31621494
Solitary Fibrous Tumors	Associate	26337721
Stomach Neoplasms	Associate	31353958, 31881968
Thymic epithelial tumor	Associate	23787439
Thymoma	Associate	23787439, 30210064
Thymus Neoplasms	Associate	23787439, 30210064
Thyroid cancer follicular	Associate	15256783, 20056739
Thyroid Cancer Papillary	Associate	20564403, 20731005, 21317881, 23025542, 23436219, 24086368, 24327398, 24798894, 36705380
Thyroid Carcinoma Anaplastic	Associate	16029487, 23806007, 34751390
Thyroid Dysgenesis	Associate	21450989, 23308388, 26617871, 28060725, 29650690, 30022773, 30240412, 30304112, 32096550, 35611983
Thyroid Dyshormonogenesis 1	Associate	32765423
Thyroid Neoplasms	Associate	15238980, 16029487, 23436219, 24086368, 24510380, 24798894, 26259532, 26695504, 27856756, 29373711, 29923329, 30210064, 32781560, 35292786, 35397361, 38277563, 9854590 View all (2 more)
Thyroid Nodule	Associate	20731005, 24798894, 25146893
Thyroiditis	Associate	25146893, 27207603, 29469940, 32096550
Urethral Neoplasms	Associate	19525927, 31932679
Urinary Bladder Neoplasms	Associate	35154515
Uterine Cervical Neoplasms	Associate	33794208, 36929174
Uterine Neoplasms	Associate	26910219
Wilms Tumor	Associate	18084247, 32507920

PAX8 (paired box 8)