Gene Gene information from NCBI Gene database.
Entrez ID 7827
Gene name NPHS2 stomatin family member, podocin
Gene symbol NPHS2
Synonyms (NCBI Gene)
PDCNSRN1
Chromosome 1
Chromosome location 1q25.2
Summary This gene encodes a protein that plays a role in the regulation of glomerular permeability. Mutations in this gene cause steroid-resistant nephrotic syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
SNPs SNP information provided by dbSNP.
46
SNP ID Visualize variation Clinical significance Consequence
rs12406197 C>A Pathogenic, likely-pathogenic, likely-benign 5 prime UTR variant
rs12568913 G>A,C,T Likely-pathogenic Stop gained, coding sequence variant, intron variant, synonymous variant, missense variant
rs61747728 C>T Uncertain-significance, pathogenic, likely-pathogenic, risk-factor Missense variant, coding sequence variant, intron variant
rs74315342 C>T Conflicting-interpretations-of-pathogenicity, pathogenic Missense variant, coding sequence variant, intron variant
rs74315343 G>A Pathogenic Stop gained, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
25
miRTarBase ID miRNA Experiments Reference
MIRT018421 hsa-miR-335-5p Microarray 18185580
MIRT735673 hsa-miR-185-5p Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR 33977784
MIRT735673 hsa-miR-185-5p Luciferase reporter assayWestern blottingMicroarrayImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCR 33977784
MIRT1190901 hsa-miR-1294 CLIP-seq
MIRT1190902 hsa-miR-134 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
LMX1B Unknown 11956244;11956245
USF1 Unknown 16572591
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0003094 Process Glomerular filtration TAS 10742096
GO:0005515 Function Protein binding IPI 12424224, 17675666, 22662192
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604766 13394 ENSG00000116218
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NP85
Protein name Podocin
Protein function Plays a role in the regulation of glomerular permeability, acting probably as a linker between the plasma membrane and the cytoskeleton.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01145 Band_7 126 300 SPFH domain / Band 7 family Family
Tissue specificity TISSUE SPECIFICITY: Almost exclusively expressed in the podocytes of fetal and mature kidney glomeruli.
Sequence
MERRARSSSRESRGRGGRTPHKENKRAKAERSGGGRGRQEAGPEPSGSGRAGTPGEPRAP
AATVVDVDEVRGSGEEGTEVVALLESERPEEGTKSSGLGACEWLLVLISLLFIIMTFPFS
IWFCVKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEIV
TKDMFIMEIDAICYYRMENASLLLSSLAHVSKAVQFLVQTTMKRLLAHRSLTEILLERKS
IAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKA

ASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGS
LPFPSPSKPVEPLNPKKKDSPML
Sequence length 383
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Nephrin family interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
416
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Chronic kidney disease Likely pathogenic; Pathogenic rs74315342 RCV001171338
Familial idiopathic steroid-resistant nephrotic syndrome Likely pathogenic; Pathogenic rs1291398331 RCV000600077
Finnish congenital nephrotic syndrome Likely pathogenic; Pathogenic rs530318579 RCV003407626
Focal segmental glomerulosclerosis Pathogenic; Likely pathogenic rs74315343, rs748812981 RCV002293976
RCV002294366
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Corticosteroids response Uncertain significance rs1553315157 RCV001254649
Gastric cancer Benign rs17278707 RCV005923858
Hepatocellular carcinoma Benign rs17278707 RCV005923857
Kidney disorder Conflicting classifications of pathogenicity; Benign; Likely benign rs762900894, rs542240453, rs5005771 RCV002294462
RCV002294174
RCV002294399
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Albuminuria Associate 18499321, 18823551, 24103534
Anti Glomerular Basement Membrane Disease Associate 14633131
Carcinoma Renal Cell Associate 26831905
Chromosome Aberrations Associate 14871423
Cicatrix Associate 20370455
Diabetes Mellitus Associate 18823551
Diabetic Nephropathies Associate 17264876, 21655212
Diabetic Nephropathies Inhibit 22615747
Disease Associate 12368218, 29637272
Edema Associate 32779421