Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7802
Gene name Gene Name - the full gene name approved by the HGNC.	Dynein axonemal light intermediate chain 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DNALI1
Synonyms (NCBI Gene) Gene synonyms aliases	P28, SPGF83, dJ423B22.5, hp28
Disease Acronyms (UniProt) Disease acronyms from UniProt database	SPGF83
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p34.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are se

Show/Hide all(45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017518	hsa-miR-335-5p	Microarray	18185580
MIRT460009	hsa-miR-548aa	PAR-CLIP	23592263
MIRT460008	hsa-miR-548ap-3p	PAR-CLIP	23592263
MIRT460007	hsa-miR-548t-3p	PAR-CLIP	23592263
MIRT460006	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT460005	hsa-miR-665	PAR-CLIP	23592263
MIRT460004	hsa-miR-539-5p	PAR-CLIP	23592263
MIRT460003	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT460002	hsa-miR-6077	PAR-CLIP	23592263
MIRT460009	hsa-miR-548aa	PAR-CLIP	23592263
MIRT460008	hsa-miR-548ap-3p	PAR-CLIP	23592263
MIRT460007	hsa-miR-548t-3p	PAR-CLIP	23592263
MIRT460006	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT460005	hsa-miR-665	PAR-CLIP	23592263
MIRT460004	hsa-miR-539-5p	PAR-CLIP	23592263
MIRT460003	hsa-miR-7-5p	PAR-CLIP	23592263
MIRT460002	hsa-miR-6077	PAR-CLIP	23592263
MIRT942125	hsa-miR-1255a	CLIP-seq
MIRT942126	hsa-miR-1255b	CLIP-seq
MIRT942127	hsa-miR-1293	CLIP-seq
MIRT942128	hsa-miR-1913	CLIP-seq
MIRT942129	hsa-miR-298	CLIP-seq
MIRT942130	hsa-miR-3074-5p	CLIP-seq
MIRT942131	hsa-miR-3120-5p	CLIP-seq
MIRT942132	hsa-miR-3163	CLIP-seq
MIRT942133	hsa-miR-3189-5p	CLIP-seq
MIRT942134	hsa-miR-3198	CLIP-seq
MIRT942135	hsa-miR-324-3p	CLIP-seq
MIRT942136	hsa-miR-3660	CLIP-seq
MIRT942137	hsa-miR-3662	CLIP-seq
MIRT942138	hsa-miR-3688-3p	CLIP-seq
MIRT942139	hsa-miR-3978	CLIP-seq
MIRT942140	hsa-miR-4309	CLIP-seq
MIRT942141	hsa-miR-4483	CLIP-seq
MIRT942142	hsa-miR-4502	CLIP-seq
MIRT942143	hsa-miR-4526	CLIP-seq
MIRT942144	hsa-miR-4659a-3p	CLIP-seq
MIRT942145	hsa-miR-4659b-3p	CLIP-seq
MIRT942146	hsa-miR-4694-3p	CLIP-seq
MIRT942147	hsa-miR-4722-3p	CLIP-seq
MIRT942148	hsa-miR-4758-3p	CLIP-seq
MIRT942149	hsa-miR-4796-5p	CLIP-seq
MIRT942150	hsa-miR-633	CLIP-seq
MIRT1978906	hsa-miR-4699-3p	CLIP-seq
MIRT1978907	hsa-miR-4766-5p	CLIP-seq

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003774	Function	Motor activity	IEA
GO:0005515	Function	Protein binding	IPI	15383276, 17500595, 23455924, 25416956, 27173435, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IDA	19944400
GO:0005929	Component	Cilium	IDA	27120127
GO:0005930	Component	Axoneme	IBA	21873635
GO:0005930	Component	Axoneme	IDA	23849778, 26909801, 31178125
GO:0030175	Component	Filopodium	IBA	21873635
GO:0030286	Component	Dynein complex	IEA
GO:0031514	Component	Motile cilium	IDA	31178125
GO:0036126	Component	Sperm flagellum	IDA	31178125
GO:0045504	Function	Dynein heavy chain binding	IBA	21873635
GO:0097729	Component	9+2 motile cilium	IDA	26909801

MIM	HGNC	e!Ensembl
602135	14353	ENSG00000163879

Protein

UniProt ID

O14645

Protein name

Axonemal dynein light intermediate polypeptide 1 (Inner dynein arm light chain, axonemal) (hp28)

Protein function

Involved in sperm flagellum assembly.

PDB

8J07

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10211	Ax_dynein_light	66 → 252	Axonemal dynein light chain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in many tissues. A smaller 0.9 kb and a larger 2.5 kb transcripts were detected at the highest level in the testis, at medium levels in the prostate, heart, liver, lung and pancreas, at low levels in the ovary, skeletal muscl

Sequence

MIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKTKLPSTPCVPD
PTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGI
CPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKAL
QAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLK
RTNQQLKAQLEGIIAPKK

Sequence length

258

Interactions

View interactions

	KEGG
	Motor proteins Amyotrophic lateral sclerosis Huntington disease Pathways of neurodegeneration - multiple diseases

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Spermatogenic Failure	spermatogenic failure 83			GenCC

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Asthenozoospermia	Associate	36726469
Breast Neoplasms	Associate	24553345
Congenital Abnormalities	Associate	36726469
Lymphoma Non Hodgkin	Associate	37955080
Nasopharyngeal Carcinoma	Associate	30935420

DNALI1 (dynein axonemal light intermediate chain 1)