Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7791
Gene name	Zyxin
Gene symbol	ZYX
Synonyms (NCBI Gene)	ESP-2HED-2
Chromosome	7
Chromosome location	7q34
Summary	Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and alon

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006534	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	21360639
MIRT006534	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	21360639
MIRT006534	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	21360639
MIRT006534	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	21360639
MIRT007089	hsa-miR-16-1-3p	qRT-PCR	23175429
MIRT025817	hsa-miR-7-5p	Microarray	19073608
MIRT027220	hsa-miR-103a-3p	Sequencing	20371350
MIRT027881	hsa-miR-96-5p	Sequencing	20371350
MIRT046890	hsa-miR-221-3p	CLASH	23622248
MIRT041336	hsa-miR-193b-3p	CLASH	23622248
MIRT038247	hsa-miR-330-5p	CLASH	23622248
MIRT038134	hsa-miR-423-5p	CLASH	23622248
MIRT1544901	hsa-miR-1	CLIP-seq
MIRT1544902	hsa-miR-103a	CLIP-seq
MIRT1544903	hsa-miR-107	CLIP-seq
MIRT1544904	hsa-miR-1275	CLIP-seq
MIRT1544905	hsa-miR-1321	CLIP-seq
MIRT1544906	hsa-miR-15a	CLIP-seq
MIRT1544907	hsa-miR-15b	CLIP-seq
MIRT1544908	hsa-miR-16	CLIP-seq
MIRT1544909	hsa-miR-195	CLIP-seq
MIRT1544910	hsa-miR-206	CLIP-seq
MIRT1544911	hsa-miR-3184	CLIP-seq
MIRT1544912	hsa-miR-3674	CLIP-seq
MIRT1544913	hsa-miR-3689a-3p	CLIP-seq
MIRT1544914	hsa-miR-3689c	CLIP-seq
MIRT1544915	hsa-miR-3690	CLIP-seq
MIRT1544916	hsa-miR-3944-5p	CLIP-seq
MIRT1544917	hsa-miR-3978	CLIP-seq
MIRT1544918	hsa-miR-424	CLIP-seq
MIRT1544919	hsa-miR-4254	CLIP-seq
MIRT1544920	hsa-miR-4489	CLIP-seq
MIRT1544921	hsa-miR-4519	CLIP-seq
MIRT1544922	hsa-miR-4525	CLIP-seq
MIRT1544923	hsa-miR-4665-5p	CLIP-seq
MIRT1544924	hsa-miR-4723-5p	CLIP-seq
MIRT1544925	hsa-miR-4728-5p	CLIP-seq
MIRT1544926	hsa-miR-4739	CLIP-seq
MIRT1544927	hsa-miR-4756-5p	CLIP-seq
MIRT1544928	hsa-miR-497	CLIP-seq
MIRT1544929	hsa-miR-613	CLIP-seq
MIRT1544930	hsa-miR-625	CLIP-seq
MIRT1544931	hsa-miR-885-3p	CLIP-seq
MIRT1544902	hsa-miR-103a	CLIP-seq
MIRT1544903	hsa-miR-107	CLIP-seq
MIRT1557348	hsa-miR-323-5p	CLIP-seq
MIRT1557348	hsa-miR-323-5p	CLIP-seq
MIRT2164560	hsa-miR-1908	CLIP-seq
MIRT2164561	hsa-miR-1915	CLIP-seq
MIRT2164562	hsa-miR-3141	CLIP-seq
MIRT2164563	hsa-miR-4685-5p	CLIP-seq
MIRT2164564	hsa-miR-4706	CLIP-seq
MIRT2164565	hsa-miR-4713-3p	CLIP-seq
MIRT2164566	hsa-miR-4749-5p	CLIP-seq
MIRT2164567	hsa-miR-542-5p	CLIP-seq
MIRT2164568	hsa-miR-663	CLIP-seq
MIRT2164569	hsa-miR-342-5p	CLIP-seq
MIRT2164570	hsa-miR-4651	CLIP-seq
MIRT2164571	hsa-miR-4664-5p	CLIP-seq
MIRT2164572	hsa-miR-4781-3p	CLIP-seq
MIRT2164573	hsa-miR-520d-5p	CLIP-seq
MIRT2164574	hsa-miR-524-5p	CLIP-seq
MIRT2164575	hsa-miR-608	CLIP-seq
MIRT1544902	hsa-miR-103a	CLIP-seq
MIRT1544903	hsa-miR-107	CLIP-seq
MIRT1557348	hsa-miR-323-5p	CLIP-seq
MIRT1544902	hsa-miR-103a	CLIP-seq
MIRT1544903	hsa-miR-107	CLIP-seq
MIRT1544904	hsa-miR-1275	CLIP-seq
MIRT1544922	hsa-miR-4525	CLIP-seq
MIRT1544923	hsa-miR-4665-5p	CLIP-seq
MIRT1544924	hsa-miR-4723-5p	CLIP-seq
MIRT1544925	hsa-miR-4728-5p	CLIP-seq
MIRT1544930	hsa-miR-625	CLIP-seq
MIRT1544931	hsa-miR-885-3p	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IBA
GO:0001725	Component	Stress fiber	IDA	18297730, 24036928
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	10801818, 10831611, 23840749, 25416956, 26871637, 28514442, 29892012, 31413325, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	24036928
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005912	Component	Adherens junction	IDA	8940160
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	12417594, 18297730
GO:0005925	Component	Focal adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IC	24036928
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	24036928
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	24036928
GO:0007267	Process	Cell-cell signaling	TAS	8940160
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0043149	Process	Stress fiber assembly	IMP	24036928
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0071346	Process	Cellular response to type II interferon	IEA

MIM	HGNC	e!Ensembl
602002	13200	ENSG00000159840

Q15942

Protein name

Zyxin (Zyxin-2)

Protein function

Adhesion plaque protein. Binds alpha-actinin and the CRP protein. Important for targeting TES and ENA/VASP family members to focal adhesions and for the formation of actin-rich structures. May be a component of a signal transduction pathway that

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00412	LIM	384 → 441	LIM domain	Domain
PF00412	LIM	444 → 500	LIM domain	Domain
PF00412	LIM	504 → 570	LIM domain	Domain

Sequence

MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRV
GEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPP
PEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATP
FSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQS
QTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE
ALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELE
QLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ
GQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGT
SFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDC
GKPLSIEADDNGCFPLDGHVLCRKCHTARAQT

Sequence length

572

Interactions

View interactions

	KEGG
	Focal adhesion Cytoskeleton in muscle cells

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	23330981, 33712570	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	35740950	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	16680155, 35769513, 37547758	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Inhibit	35740950	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Inhibit	27837684	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Associate	37974210	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Inhibit	22868251	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Associate	21360639	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	16959042	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Stimulate	11841540	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	25048347	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	15649318	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Associate	36763793	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	20705921	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZYX (zyxin)