Gene Gene information from NCBI Gene database.
Entrez ID 7781
Gene name Solute carrier family 30 member 3
Gene symbol SLC30A3
Synonyms (NCBI Gene)
ZNT3
Chromosome 2
Chromosome location 2p23.3
miRNA miRNA information provided by mirtarbase database.
176
miRTarBase ID miRNA Experiments Reference
MIRT607465 hsa-miR-8485 HITS-CLIP 23824327
MIRT634030 hsa-miR-548aa HITS-CLIP 23824327
MIRT634029 hsa-miR-548ap-3p HITS-CLIP 23824327
MIRT634028 hsa-miR-548t-3p HITS-CLIP 23824327
MIRT607465 hsa-miR-8485 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
38
GO ID Ontology Definition Evidence Reference
GO:0005385 Function Zinc ion transmembrane transporter activity IBA
GO:0005385 Function Zinc ion transmembrane transporter activity IDA 17349999, 19521526, 26647834
GO:0005385 Function Zinc ion transmembrane transporter activity IEA
GO:0005515 Function Protein binding IPI 25416956, 25657003, 26728129, 32296183, 33961781, 36204728
GO:0005737 Component Cytoplasm IDA 17349999
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602878 11014 ENSG00000115194
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99726
Protein name Probable proton-coupled zinc antiporter SLC30A3 (Solute carrier family 30 member 3) (Zinc transporter 3) (ZnT-3)
Protein function Probable proton-coupled zinc ion antiporter mediating the import of zinc from cytoplasm into synaptic vesicles and participating to cellular zinc ion homeostasis in the brain. {ECO:0000269|PubMed:17349999, ECO:0000269|PubMed:19521526, ECO:000026
PDB 8XN1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01545 Cation_efflux 76 293 Cation efflux family Family
Sequence
MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPL
PPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSL
FSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAM
LLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLGNTSVRAAFVHVL
GDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILM
EGTPRNV
GFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRF
GFSSCTLQVEQYQPEMAQCLRCQEPPQA
Sequence length 388
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Febrile seizure (within the age range of 3 months to 6 years) Uncertain significance rs779570928 RCV001839217
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Inhibit 22640423
Amyotrophic lateral sclerosis 1 Inhibit 32599739
Depressive Disorder Major Inhibit 27661418
Neoplasms Associate 39596116
Zinc Deficiency Neonatal due to Low Breast Milk Zinc Associate 25657003