Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7780
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 30 member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC30A2
Synonyms (NCBI Gene) Gene synonyms aliases	PP12488, TNZD, ZNT2, ZnT-2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	TNZD
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a zinc transporter that acts as a homodimer. The encoded protein plays a role in secreting zinc into breast milk. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, A

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs185398527	C>T	Pathogenic	Coding sequence variant, missense variant
rs587776926	T>C	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017045	hsa-miR-335-5p	Microarray	18185580
MIRT515990	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT515989	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT515988	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT515987	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT515986	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT515985	hsa-miR-6511b-5p	PAR-CLIP	23446348
MIRT515984	hsa-miR-6811-5p	PAR-CLIP	23446348
MIRT515983	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT515990	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT515989	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT515988	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT515987	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT515986	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT515985	hsa-miR-6511b-5p	PAR-CLIP	23446348
MIRT515984	hsa-miR-6811-5p	PAR-CLIP	23446348
MIRT515983	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT1359093	hsa-miR-130a	CLIP-seq
MIRT1359094	hsa-miR-130b	CLIP-seq
MIRT1359095	hsa-miR-24	CLIP-seq
MIRT1359096	hsa-miR-2682	CLIP-seq
MIRT1359097	hsa-miR-298	CLIP-seq
MIRT1359098	hsa-miR-301a	CLIP-seq
MIRT1359099	hsa-miR-301b	CLIP-seq
MIRT1359100	hsa-miR-3184	CLIP-seq
MIRT1359101	hsa-miR-3612	CLIP-seq
MIRT1359102	hsa-miR-3666	CLIP-seq
MIRT1359103	hsa-miR-423-5p	CLIP-seq
MIRT1359104	hsa-miR-4283	CLIP-seq
MIRT1359105	hsa-miR-4295	CLIP-seq
MIRT1359106	hsa-miR-432	CLIP-seq
MIRT1359107	hsa-miR-4330	CLIP-seq
MIRT1359108	hsa-miR-4437	CLIP-seq
MIRT1359109	hsa-miR-4443	CLIP-seq
MIRT1359110	hsa-miR-4473	CLIP-seq
MIRT1359111	hsa-miR-449c	CLIP-seq
MIRT1359112	hsa-miR-4534	CLIP-seq
MIRT1359113	hsa-miR-454	CLIP-seq
MIRT1359114	hsa-miR-4671-3p	CLIP-seq
MIRT1359115	hsa-miR-4687-3p	CLIP-seq
MIRT1359116	hsa-miR-4802-5p	CLIP-seq
MIRT1359117	hsa-miR-485-5p	CLIP-seq
MIRT1359118	hsa-miR-650	CLIP-seq
MIRT1359119	hsa-miR-940	CLIP-seq
MIRT2106342	hsa-miR-3136-3p	CLIP-seq
MIRT2330637	hsa-miR-1266	CLIP-seq
MIRT2330638	hsa-miR-4518	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005385	Function	Zinc ion transmembrane transporter activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	25416956, 25657003, 25910212, 26728129, 26871637, 31515488, 32296183
GO:0005737	Component	Cytoplasm	IDA	17349999
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005770	Component	Late endosome	IDA	17349999
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0010043	Process	Response to zinc ion	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:0042802	Function	Identical protein binding	IPI	25657003
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0061088	Process	Regulation of sequestering of zinc ion	IBA	21873635
GO:0061090	Process	Positive regulation of sequestering of zinc ion	IDA	17349999
GO:0071577	Process	Zinc ion transmembrane transport	IBA	21873635

MIM	HGNC	e!Ensembl
609617	11013	ENSG00000158014

Protein

UniProt ID

Q9BRI3

Protein name

Proton-coupled zinc antiporter SLC30A2 (Solute carrier family 30 member 2) (Zinc transporter 2) (ZnT-2)

Protein function

[Isoform 1]: Electroneutral proton-coupled antiporter concentrating zinc ions into a variety of intracellular organelles including endosomes, zymogen granules and mitochondria. Thereby, plays a crucial role in cellular zinc homeostasis to confer

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01545	Cation_efflux	76 → 229	Cation efflux family	Family

Sequence

MEAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPD
SHCDPKKGKAQRQLYVASAICLLFMIGEVVEILGALVSVLSIWVVTGVLVYLAVERLISG
DYEIDGGTMLITSGCAVAVNIIMGLTLHQSGHGHSHGTTNQQEENPSVRAAFIHVIGDFM
QSMGVLVAAYILYFKPEYKYVDPICTFVFSILVLGTTLTILRDVILVLMEGTPKGVDFTA
VRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHT
VTIQIEDYSEDMKDCQACQGPSD

Sequence length

323

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Zinc deficiency	Zinc Deficiency, Neonatal, due to Low Breast Milk Zinc	rs587776926, rs185398527	17065149, 22733820

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental Depression	Mental Depression			GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	35049094
Hyperlipoproteinemia Type II	Associate	20579458
Neoplasm Metastasis	Inhibit	37591783
Prostatic Neoplasms	Associate	35049094
Stomach Neoplasms	Associate	33110097, 37591783, 39473403
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Associate	22733820, 24451381, 25657003, 27137936, 27304099, 30450693

SLC30A2 (solute carrier family 30 member 2)