ZNF232 (zinc finger protein 232)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7775
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 232
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF232
Synonyms (NCBI Gene) Gene synonyms aliases
ZSCAN11
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p13.2
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 20211142, 25416956, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
616463 13026 ENSG00000167840
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9UNY5
Protein name Zinc finger protein 232 (Zinc finger and SCAN domain-containing protein 11)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 48 → 137 SCAN domain Domain
PF00096 zf-C2H2 276 → 298 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 304 → 326 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 332 → 354 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 360 → 382 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Higher expression seen in the liver, testis and ovary.
Sequence 
MAVSLTAAETLALQGTQGQEKMMMMGPKEEEQSCEYETRLPGNHSTSQEIFRQRFRHLRY
QETPGPREALSQLRVLCCEWLRPEKHTKEQILEFLVLEQFLTILPEELQSWVRGHHPKSG
EEAVTVLEDLEKGLEPEPQVPGPAHGPAQEEPWEKKESLGAAQEALSIQLQPKETQPFPK
SEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQ
QRNPKAERLRWSPAQEESFRQMVVIHKEIPTGKKDHECSECGKTFIYNSHLVVHQRVHSG
EKPYKCSDCGKTFKQSSNLGQHQRIHTGEKPFECNECGKAFRWGAHLVQHQRIHSGEKPY
ECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWCSELIRHRRVHARKEPSH
Sequence length 417
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Show/Hide Text Mining Associations (4)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 33152005
Autoimmune Diseases Associate 33152005
Frontotemporal Dementia Associate 33152005
Lung Neoplasms Associate 37167549