Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7762
Gene name	Zinc finger protein 215
Gene symbol	ZNF215
Synonyms (NCBI Gene)	BAZ-2BAZ2ZKSCAN11ZSCAN43
Chromosome	11
Chromosome location	11p15.4
Summary	This gene is imprinted in a tissue-specific manner with preferential expression in the testis, and encodes a zinc finger protein that belongs to a family of zinc finger transcription factors. The encoded protein contains an N-terminal SRE-ZBP, Ctfin51, AW

Show/Hide all (83)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024381	hsa-miR-215-5p	Microarray	19074876
MIRT026389	hsa-miR-192-5p	Microarray	19074876
MIRT054587	hsa-miR-100-5p	qRT-PCRWestern blot	23778488
MIRT563137	hsa-miR-4302	PAR-CLIP	20371350
MIRT563136	hsa-miR-1825	PAR-CLIP	20371350
MIRT563135	hsa-miR-199a-5p	PAR-CLIP	20371350
MIRT563134	hsa-miR-199b-5p	PAR-CLIP	20371350
MIRT563133	hsa-miR-766-3p	PAR-CLIP	20371350
MIRT563132	hsa-miR-3925-3p	PAR-CLIP	20371350
MIRT563131	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT563130	hsa-miR-206	PAR-CLIP	20371350
MIRT563129	hsa-miR-613	PAR-CLIP	20371350
MIRT563128	hsa-miR-1257	PAR-CLIP	20371350
MIRT563127	hsa-miR-450a-2-3p	PAR-CLIP	20371350
MIRT563126	hsa-miR-4260	PAR-CLIP	20371350
MIRT563125	hsa-miR-5572	PAR-CLIP	20371350
MIRT563124	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT563137	hsa-miR-4302	PAR-CLIP	20371350
MIRT563136	hsa-miR-1825	PAR-CLIP	20371350
MIRT563135	hsa-miR-199a-5p	PAR-CLIP	20371350
MIRT563134	hsa-miR-199b-5p	PAR-CLIP	20371350
MIRT563133	hsa-miR-766-3p	PAR-CLIP	20371350
MIRT563132	hsa-miR-3925-3p	PAR-CLIP	20371350
MIRT563131	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT563130	hsa-miR-206	PAR-CLIP	20371350
MIRT563129	hsa-miR-613	PAR-CLIP	20371350
MIRT563128	hsa-miR-1257	PAR-CLIP	20371350
MIRT563127	hsa-miR-450a-2-3p	PAR-CLIP	20371350
MIRT563126	hsa-miR-4260	PAR-CLIP	20371350
MIRT563125	hsa-miR-5572	PAR-CLIP	20371350
MIRT563124	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT563137	hsa-miR-4302	PAR-CLIP	20371350
MIRT563136	hsa-miR-1825	PAR-CLIP	20371350
MIRT563135	hsa-miR-199a-5p	PAR-CLIP	20371350
MIRT563134	hsa-miR-199b-5p	PAR-CLIP	20371350
MIRT563133	hsa-miR-766-3p	PAR-CLIP	20371350
MIRT563132	hsa-miR-3925-3p	PAR-CLIP	20371350
MIRT563131	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT563130	hsa-miR-206	PAR-CLIP	20371350
MIRT563129	hsa-miR-613	PAR-CLIP	20371350
MIRT563128	hsa-miR-1257	PAR-CLIP	20371350
MIRT563127	hsa-miR-450a-2-3p	PAR-CLIP	20371350
MIRT563126	hsa-miR-4260	PAR-CLIP	20371350
MIRT563125	hsa-miR-5572	PAR-CLIP	20371350
MIRT563124	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT563137	hsa-miR-4302	PAR-CLIP	20371350
MIRT563136	hsa-miR-1825	PAR-CLIP	20371350
MIRT563135	hsa-miR-199a-5p	PAR-CLIP	20371350
MIRT563134	hsa-miR-199b-5p	PAR-CLIP	20371350
MIRT563133	hsa-miR-766-3p	PAR-CLIP	20371350
MIRT563132	hsa-miR-3925-3p	PAR-CLIP	20371350
MIRT563131	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT563130	hsa-miR-206	PAR-CLIP	20371350
MIRT563129	hsa-miR-613	PAR-CLIP	20371350
MIRT563128	hsa-miR-1257	PAR-CLIP	20371350
MIRT563127	hsa-miR-450a-2-3p	PAR-CLIP	20371350
MIRT563126	hsa-miR-4260	PAR-CLIP	20371350
MIRT563125	hsa-miR-5572	PAR-CLIP	20371350
MIRT563124	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT1518157	hsa-miR-1200	CLIP-seq
MIRT1518158	hsa-miR-4324	CLIP-seq
MIRT1518159	hsa-miR-450b-3p	CLIP-seq
MIRT1518160	hsa-miR-4713-3p	CLIP-seq
MIRT1518161	hsa-miR-544b	CLIP-seq
MIRT1518162	hsa-miR-548b-3p	CLIP-seq
MIRT1518163	hsa-miR-638	CLIP-seq
MIRT1518164	hsa-miR-769-3p	CLIP-seq
MIRT2375980	hsa-miR-1292	CLIP-seq
MIRT2375981	hsa-miR-297	CLIP-seq
MIRT2375982	hsa-miR-3120-3p	CLIP-seq
MIRT2375983	hsa-miR-3149	CLIP-seq
MIRT2375984	hsa-miR-3653	CLIP-seq
MIRT2375985	hsa-miR-3658	CLIP-seq
MIRT2375986	hsa-miR-4318	CLIP-seq
MIRT2375987	hsa-miR-4471	CLIP-seq
MIRT2375988	hsa-miR-4652-3p	CLIP-seq
MIRT2375989	hsa-miR-4693-5p	CLIP-seq
MIRT2375990	hsa-miR-4753-3p	CLIP-seq
MIRT2375991	hsa-miR-495	CLIP-seq
MIRT2375992	hsa-miR-541	CLIP-seq
MIRT2375993	hsa-miR-630	CLIP-seq
MIRT2375994	hsa-miR-654-5p	CLIP-seq
MIRT2375995	hsa-miR-892a	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	10762538
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
605016	13007	ENSG00000149054

Q9UL58

Protein name

Zinc finger protein 215 (BWSCR2-associated zinc finger protein 2) (BAZ-2) (Zinc finger protein with KRAB and SCAN domains 11)

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02023	SCAN	44 → 133	SCAN domain	Domain
PF01352	KRAB	163 → 203	KRAB box	Family
PF00096	zf-C2H2	379 → 401	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	407 → 429	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	462 → 484	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	490 → 512	Zinc finger, C2H2 type	Domain

Sequence

MQPLSKLMAISKPRNLSLREQREVLRADMSWQQETNPVVETHDSEASRQKFRHFQYLKVS
GPHEALSQLWELCLQWLRPEIHTKKQIIELLVLEQFLAILPEEVRTWVNLQHPNNSKDMV
TLIEDVIEMLEDEDMPCKDSALQMGSIKEKMKAGSRTGKPQEPVTFKDVVVEFSKEEWGQ
LDSAVKNLYRNVMLENFRNLNSLRKAHLLSKPFESLKLESKKKRWIMEKEIPRKTIFDMK
SISGEESSHGVIMTRLTESGHPSSDAWKGENWLYRNQKKWDINLPQEAFIPETIYTEEED
FECSENKKSFDINSVSSICAIQVGIPSRKGSPKCDKFKTYFKFNLDSVGKQHSEYEYGND
LSLSTDIRHQKSHTTMNSYECYQCGKAFCRSSSLIRHQIIHTGEKPYKCSECGRFFNRRT
NLTKHQKLHAEAKACTSNKCGKAFSKSEDSNNPTLHFGNNFYQCVNCGKSFNRSSSLIRH
QMIHTGEKPFKCKECSKAFNRSSNLVKHQKLHTRDKS

Sequence length

517

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BECKWITH-WIEDEMANN SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-OPERATIVE ACUTE KIDNEY INJURY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Beckwith Wiedemann Syndrome	Associate	10762538	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Associate	23025704	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	37574751	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Associate	23778488	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF215 (zinc finger protein 215)