Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	7755
Gene name	Zinc finger protein 205
Gene symbol	ZNF205
Synonyms (NCBI Gene)	RhitHZNF210Zfp13
Chromosome	16
Chromosome location	16p13.3

Show/Hide all (10)

miRTarBase ID	miRNA	Experiments
MIRT2156314	hsa-miR-3124-3p	CLIP-seq
MIRT2156315	hsa-miR-3178	CLIP-seq
MIRT2156316	hsa-miR-4292	CLIP-seq
MIRT2156317	hsa-miR-4486	CLIP-seq
MIRT2375896	hsa-miR-1225-3p	CLIP-seq
MIRT2375897	hsa-miR-3183	CLIP-seq
MIRT2375898	hsa-miR-4723-3p	CLIP-seq
MIRT2375899	hsa-miR-4740-3p	CLIP-seq
MIRT2375900	hsa-miR-4749-3p	CLIP-seq
MIRT2375901	hsa-miR-615-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
FOXP3	Unknown	22306510
GABPA	Unknown	22306510

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	22306510
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16713569, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	9787081
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	9787081
GO:0009891	Process	Positive regulation of biosynthetic process	IEA
GO:0010729	Process	Positive regulation of hydrogen peroxide biosynthetic process	IMP	22306510
GO:0046872	Function	Metal ion binding	IEA
GO:1901030	Process	Positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IMP	22306510

MIM	HGNC	e!Ensembl
603436	12996	ENSG00000122386

O95201

Protein name

Transcriptional repressor RHIT (Repressor of heat-inducible transcription) (RhitH) (Zinc finger protein 205) (Zinc finger protein 210)

Protein function

Transcriptional repressor involved in regulating MPV17L expression (PubMed:22306510). By regulating MPV17L expression, contributes to the regulation of genes involved in H(2)O(2) metabolism and the mitochondrial apoptotic cascade (PubMed:2230651

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	123 → 162	KRAB box	Family
PF00096	zf-C2H2	308 → 330	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	336 → 358	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	364 → 386	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	392 → 414	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	420 → 442	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	448 → 470	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	476 → 498	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	504 → 526	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, skeletal muscle, pancreas and brain. Weakly expressed in placenta, lung, liver, kidney and thymus.

Sequence

MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDTQESLHIKMEPEEPHSEG
ASQEDGAQGAWGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWS
QMPVTFEDVALYLSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEA
SGSSRQAGDEKEWRGACTGAVEVGQRVQTSSVAALGNVKPFRTRAGRVQWGVPQCAQEAA
CGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPEKPNEEEKGAPESGEEGLAPD
SEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTG
EKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH
KCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLD
CGKSFSHSSHLTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGA
AAAGALATPPPAPT

Sequence length

554

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

ZNF205 (zinc finger protein 205)