ZNF205 (zinc finger protein 205)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7755
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 205
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF205
Synonyms (NCBI Gene) Gene synonyms aliases
RhitH, ZNF210, Zfp13
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT2156314 hsa-miR-3124-3p CLIP-seq
MIRT2156315 hsa-miR-3178 CLIP-seq
MIRT2156316 hsa-miR-4292 CLIP-seq
MIRT2156317 hsa-miR-4486 CLIP-seq
MIRT2375896 hsa-miR-1225-3p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
FOXP3 Unknown 22306510
GABPA Unknown 22306510
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 22306510
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IEA
GO:0005515 Function Protein binding IPI 16713569, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603436 12996 ENSG00000122386
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O95201
Protein name Transcriptional repressor RHIT (Repressor of heat-inducible transcription) (RhitH) (Zinc finger protein 205) (Zinc finger protein 210)
Protein function Transcriptional repressor involved in regulating MPV17L expression (PubMed:22306510). By regulating MPV17L expression, contributes to the regulation of genes involved in H(2)O(2) metabolism and the mitochondrial apoptotic cascade (PubMed:2230651
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 123 → 162 KRAB box Family
PF00096 zf-C2H2 308 → 330 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 336 → 358 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 364 → 386 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 392 → 414 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 420 → 442 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 448 → 470 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 476 → 498 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 504 → 526 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, skeletal muscle, pancreas and brain. Weakly expressed in placenta, lung, liver, kidney and thymus.
Sequence 
MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDTQESLHIKMEPEEPHSEG
ASQEDGAQGAWGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWS
QMPVTFEDVALYLSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEA
SGSSRQAGDEKEWRGACTGAVEVGQRVQTSSVAALGNVKPFRTRAGRVQWGVPQCAQEAA
CGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPEKPNEEEKGAPESGEEGLAPD
SEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTG
EKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH
KCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLD
CGKSFSHSSHLTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGA
AAAGALATPPPAPT
Sequence length 554
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 27768594