Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7746
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger and SCAN domain containing 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZSCAN9
Synonyms (NCBI Gene) Gene synonyms aliases
PRD51, ZNF193
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT449116 hsa-miR-8069 PAR-CLIP 22100165
MIRT449115 hsa-miR-7641 PAR-CLIP 22100165
MIRT449116 hsa-miR-8069 PAR-CLIP 22100165
MIRT449115 hsa-miR-7641 PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 20211142, 25416956, 31515488, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602246 12984 ENSG00000137185
Protein
UniProt ID O15535
Protein name Zinc finger and SCAN domain-containing protein 9 (Cell proliferation-inducing gene 12 protein) (PRD51) (Zinc finger protein 193)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 48 137 SCAN domain Domain
PF00096 zf-C2H2 254 276 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 282 304 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 310 332 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 338 360 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 366 388 Zinc finger, C2H2 type Domain
Sequence
MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRLKRSNPLAREIFRRHFRQLCY
QETPGPREALTRLQELCYQWLRPHVSTKEQILDLLVLEQFLSILPKELQGWVREHCPESG
EEAVILLEDLERELDEP
QHEMVAHRHRQEVLCKEMVPLAEQTPLTLQSQPKEPQLTCDSA
QKCHSIGETDEVTKTEDRELVLRKDCPKIVEPHGKMFNEQTWEVSQQDPSHGEVGEHKDR
IERQWGNLLGEGQHKCDECGKSFTQSSGLIRHQRIHTGERPYECNECGKAFSRSSGLFNH
RGIH
NIQKRYHCKECGKVFSQSAGLIQHQRIHKGEKPYQCSQCSKSYSRRSFLIEHQRSH
TGERPHQCIECGKSFNRHCNLIRHQKIHTVAELV
Sequence length 394
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dental caries Dental caries N/A N/A GWAS
Lung adenocarcinoma Familial squamous cell lung carcinoma N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 23223422
Hemochromatosis Associate 18990219