ZSCAN9 (zinc finger and SCAN domain containing 9)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 7746
Gene name Zinc finger and SCAN domain containing 9
Gene symbol ZSCAN9
Synonyms (NCBI Gene)
PRD51ZNF193
Chromosome 6
Chromosome location 6p22.1
miRNA miRNA information provided by mirtarbase database.
4
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (4)
miRTarBase ID miRNA Experiments Reference
MIRT449116 hsa-miR-8069 PAR-CLIP 22100165
MIRT449115 hsa-miR-7641 PAR-CLIP 22100165
MIRT449116 hsa-miR-8069 PAR-CLIP 22100165
MIRT449115 hsa-miR-7641 PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 20211142, 25416956, 31515488, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
602246 12984 ENSG00000137185
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15535
Protein name Zinc finger and SCAN domain-containing protein 9 (Cell proliferation-inducing gene 12 protein) (PRD51) (Zinc finger protein 193)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 48 → 137 SCAN domain Domain
PF00096 zf-C2H2 254 → 276 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 282 → 304 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 310 → 332 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 338 → 360 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 366 → 388 Zinc finger, C2H2 type Domain
Sequence 
MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRLKRSNPLAREIFRRHFRQLCY
QETPGPREALTRLQELCYQWLRPHVSTKEQILDLLVLEQFLSILPKELQGWVREHCPESG
EEAVILLEDLERELDEPQHEMVAHRHRQEVLCKEMVPLAEQTPLTLQSQPKEPQLTCDSA
QKCHSIGETDEVTKTEDRELVLRKDCPKIVEPHGKMFNEQTWEVSQQDPSHGEVGEHKDR
IERQWGNLLGEGQHKCDECGKSFTQSSGLIRHQRIHTGERPYECNECGKAFSRSSGLFNH
RGIHNIQKRYHCKECGKVFSQSAGLIQHQRIHKGEKPYQCSQCSKSYSRRSFLIEHQRSH
TGERPHQCIECGKSFNRHCNLIRHQKIHTVAELV
Sequence length 394
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Gastric cancer Likely benign rs139661640 RCV005932194
Show/Hide Text Mining Associations (2)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 23223422
Hemochromatosis Associate 18990219