ZSCAN26 (zinc finger and SCAN domain containing 26)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7741
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger and SCAN domain containing 26
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZSCAN26
Synonyms (NCBI Gene) Gene synonyms aliases
SRE-ZBP, SREZBP, ZNF187
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003700 Function DNA-binding transcription factor activity NAS 1569959
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
616474 12978 ENSG00000197062
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q16670
Protein name Zinc finger and SCAN domain-containing protein 26 (Protein SRE-ZBP) (Zinc finger protein 187)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 47 → 136 SCAN domain Domain
PF00096 zf-C2H2 282 → 304 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 310 → 332 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 338 → 360 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 366 → 388 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 394 → 416 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 422 → 444 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 450 → 473 Zinc finger, C2H2 type Domain
Sequence 
MATALVSAHSLAPLNLKKEGLRVVREDHYSTWEQGFKLQGNSKGLGQEPLCKQFRQLRYE
ETTGPREALSRLRELCQQWLQPETHTKEQILELLVLEQFLIILPKELQARVQEHHPESRE
DVVVVLEDLQLDLGETGQQDPDQPKKQKILVEEMAPLKGVQEQQVRHECEVTKPEKEKGE
ETRIENGKLIVVTDSCGRVESSGKISEPMEAHNEGSNLERHQAKPKEKIEYKCSEREQRF
IQHLDLIEHASTHTGKKLCESDVCQSSSLTGHKKVLSREKGHQCHECGKAFQRSSHLVRH
QKIHLGEKPYQCNECGKVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRHQRIH
SQEEPCECKECGKTFSQALLLTHHQRIHSHSKSHQCNECGKAFSLTSDLIRHHRIHTGEK
PFKCNICQKAFRLNSHLAQHVRIHNEEKPYQCSECGEAFRQRSGLFQHQRYHHKDKLA
Sequence length 478
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Show/Hide Text Mining Associations (1)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Insulin Resistance Associate 36534481