ZSCAN26 (zinc finger and SCAN domain containing 26)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 7741
Gene name Zinc finger and SCAN domain containing 26
Gene symbol ZSCAN26
Synonyms (NCBI Gene)
SRE-ZBPSREZBPZNF187
Chromosome 6
Chromosome location 6p22.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
Gene Gene ontology Other IDs Protein
Show/Hide all (13)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003700 Function DNA-binding transcription factor activity NAS 1569959
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
616474 12978 ENSG00000197062
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16670
Protein name Zinc finger and SCAN domain-containing protein 26 (Protein SRE-ZBP) (Zinc finger protein 187)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 47 → 136 SCAN domain Domain
PF00096 zf-C2H2 282 → 304 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 310 → 332 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 338 → 360 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 366 → 388 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 394 → 416 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 422 → 444 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 450 → 473 Zinc finger, C2H2 type Domain
Sequence 
MATALVSAHSLAPLNLKKEGLRVVREDHYSTWEQGFKLQGNSKGLGQEPLCKQFRQLRYE
ETTGPREALSRLRELCQQWLQPETHTKEQILELLVLEQFLIILPKELQARVQEHHPESRE
DVVVVLEDLQLDLGETGQQDPDQPKKQKILVEEMAPLKGVQEQQVRHECEVTKPEKEKGE
ETRIENGKLIVVTDSCGRVESSGKISEPMEAHNEGSNLERHQAKPKEKIEYKCSEREQRF
IQHLDLIEHASTHTGKKLCESDVCQSSSLTGHKKVLSREKGHQCHECGKAFQRSSHLVRH
QKIHLGEKPYQCNECGKVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRHQRIH
SQEEPCECKECGKTFSQALLLTHHQRIHSHSKSHQCNECGKAFSLTSDLIRHHRIHTGEK
PFKCNICQKAFRLNSHLAQHVRIHNEEKPYQCSECGEAFRQRSGLFQHQRYHHKDKLA
Sequence length 478
Interactions View interactions