Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7738
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger protein 184
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZNF184
Synonyms (NCBI Gene) Gene synonyms aliases	kr-ZNF3
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is predicted to be a Kruppel C2H2-type zinc-finger protein family member. Sequence analysis predicts that the protein contains two Kruppel associated box (KRAB) boxes in the N-terminus and highly conserved zinc finger moti

Show/Hide all(85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024548	hsa-miR-215-5p	Microarray	19074876
MIRT026409	hsa-miR-192-5p	Microarray	19074876
MIRT1517257	hsa-miR-4495	CLIP-seq
MIRT1517258	hsa-miR-586	CLIP-seq
MIRT2156167	hsa-miR-3920	CLIP-seq
MIRT2375744	hsa-miR-3157-5p	CLIP-seq
MIRT2375745	hsa-miR-4263	CLIP-seq
MIRT2375746	hsa-miR-4690-3p	CLIP-seq
MIRT2375747	hsa-miR-4797-5p	CLIP-seq
MIRT2375748	hsa-miR-576-5p	CLIP-seq
MIRT2375749	hsa-miR-759	CLIP-seq
MIRT2668183	hsa-miR-1273d	CLIP-seq
MIRT2668184	hsa-miR-1323	CLIP-seq
MIRT2668185	hsa-miR-182	CLIP-seq
MIRT2668186	hsa-miR-2682	CLIP-seq
MIRT2668187	hsa-miR-300	CLIP-seq
MIRT2668188	hsa-miR-3120-3p	CLIP-seq
MIRT2375744	hsa-miR-3157-5p	CLIP-seq
MIRT2668189	hsa-miR-3171	CLIP-seq
MIRT2668190	hsa-miR-3606	CLIP-seq
MIRT2668191	hsa-miR-3647-3p	CLIP-seq
MIRT2668192	hsa-miR-3714	CLIP-seq
MIRT2668193	hsa-miR-381	CLIP-seq
MIRT2156167	hsa-miR-3920	CLIP-seq
MIRT2668194	hsa-miR-3922-5p	CLIP-seq
MIRT2375745	hsa-miR-4263	CLIP-seq
MIRT2668195	hsa-miR-4282	CLIP-seq
MIRT2668196	hsa-miR-4470	CLIP-seq
MIRT2668197	hsa-miR-449c	CLIP-seq
MIRT2668198	hsa-miR-4643	CLIP-seq
MIRT2668199	hsa-miR-466	CLIP-seq
MIRT2668200	hsa-miR-4666-3p	CLIP-seq
MIRT2375746	hsa-miR-4690-3p	CLIP-seq
MIRT2668201	hsa-miR-4698	CLIP-seq
MIRT2668202	hsa-miR-4719	CLIP-seq
MIRT2668203	hsa-miR-4728-3p	CLIP-seq
MIRT2668204	hsa-miR-4777-5p	CLIP-seq
MIRT2668205	hsa-miR-4789-3p	CLIP-seq
MIRT2375747	hsa-miR-4797-5p	CLIP-seq
MIRT2668206	hsa-miR-4799-5p	CLIP-seq
MIRT2668207	hsa-miR-498	CLIP-seq
MIRT2668208	hsa-miR-518d-5p	CLIP-seq
MIRT2668209	hsa-miR-519b-5p	CLIP-seq
MIRT2668210	hsa-miR-519c-5p	CLIP-seq
MIRT2668211	hsa-miR-520c-5p	CLIP-seq
MIRT2668212	hsa-miR-526a	CLIP-seq
MIRT2668213	hsa-miR-545	CLIP-seq
MIRT2668214	hsa-miR-548a-3p	CLIP-seq
MIRT2668215	hsa-miR-548e	CLIP-seq
MIRT2668216	hsa-miR-548f	CLIP-seq
MIRT2668217	hsa-miR-548o	CLIP-seq
MIRT2668218	hsa-miR-548p	CLIP-seq
MIRT2375748	hsa-miR-576-5p	CLIP-seq
MIRT2668219	hsa-miR-587	CLIP-seq
MIRT2668220	hsa-miR-605	CLIP-seq
MIRT2668221	hsa-miR-660	CLIP-seq
MIRT2375749	hsa-miR-759	CLIP-seq
MIRT2668183	hsa-miR-1273d	CLIP-seq
MIRT2668185	hsa-miR-182	CLIP-seq
MIRT2668188	hsa-miR-3120-3p	CLIP-seq
MIRT2375744	hsa-miR-3157-5p	CLIP-seq
MIRT2668189	hsa-miR-3171	CLIP-seq
MIRT2668190	hsa-miR-3606	CLIP-seq
MIRT2668191	hsa-miR-3647-3p	CLIP-seq
MIRT2668195	hsa-miR-4282	CLIP-seq
MIRT2668196	hsa-miR-4470	CLIP-seq
MIRT2668198	hsa-miR-4643	CLIP-seq
MIRT2668199	hsa-miR-466	CLIP-seq
MIRT2375746	hsa-miR-4690-3p	CLIP-seq
MIRT2668201	hsa-miR-4698	CLIP-seq
MIRT2668202	hsa-miR-4719	CLIP-seq
MIRT2668203	hsa-miR-4728-3p	CLIP-seq
MIRT2668204	hsa-miR-4777-5p	CLIP-seq
MIRT2668205	hsa-miR-4789-3p	CLIP-seq
MIRT2375747	hsa-miR-4797-5p	CLIP-seq
MIRT2668208	hsa-miR-518d-5p	CLIP-seq
MIRT2668209	hsa-miR-519b-5p	CLIP-seq
MIRT2668210	hsa-miR-519c-5p	CLIP-seq
MIRT2668211	hsa-miR-520c-5p	CLIP-seq
MIRT2668212	hsa-miR-526a	CLIP-seq
MIRT2668213	hsa-miR-545	CLIP-seq
MIRT2668218	hsa-miR-548p	CLIP-seq
MIRT2668219	hsa-miR-587	CLIP-seq
MIRT2668221	hsa-miR-660	CLIP-seq
MIRT2375749	hsa-miR-759	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	9073517
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
602277	12975	ENSG00000096654

Protein

UniProt ID

Q99676

Protein name

Zinc finger protein 184

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	27 → 68	KRAB box	Family
PF00096	zf-C2H2	222 → 244	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	250 → 272	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	306 → 328	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	334 → 356	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	362 → 384	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	390 → 412	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	418 → 440	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	446 → 468	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	474 → 496	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	502 → 524	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	530 → 552	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	558 → 580	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	586 → 608	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	614 → 636	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	642 → 664	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	670 → 692	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	698 → 720	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	726 → 748	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominant expression in testis.

Sequence

MEDLSSPDSTLLQGGHNLLSSASFQEAVTFKDVIVDFTQEEWKQLDPGQRDLFRDVTLEN
YTHLVSIGLQVSKPDVISQLEQGTEPWIMEPSIPVGTCADWETRLENSVSAPEPDISEEE
LSPEVIVEKHKRDDSWSSNLLESWEYEGSLERQQANQQTLPKEIKVTEKTIPSWEKGPVN
NEFGKSVNVSSNLVTQEPSPEETSTKRSIKQNSNPVKKEKSCKCNECGKAFSYCSALIRH
QRTHTGEKPYKCNECEKAFSRSENLINHQRIHTGDKPYKCDQCGKGFIEGPSLTQHQRIH
TGEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCNECGKAFSQRGHFMEHQKIHTGEK
PFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYEC
NECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCNECG
KAFSYCSSLTQHRRIHTREKPFECSECGKAFSYLSNLNQHQKTHTQEKAYECKECGKAFI
RSSSLAKHERIHTGEKPYQCHECGKTFSYGSSLIQHRKIHTGERPYKCNECGRAFNQNIH
LTQHKRIHTGAKPYECAECGKAFRHCSSLAQHQKTHTEEKPYQCNKCEKTFSQSSHLTQH
QRIHTGEKPYKCNECDKAFSRSTHLTEHQNTHTGEKPYNCNECRKTFSQSTYLIQHQRIH
SGEKPFGCNDCGKSFRYRSALNKHQRLHPGI

Sequence length

751

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bipolar Disorder	Bipolar disorder	N/A	N/A	GWAS
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Hyperthyroidism	Hyperthyroidism	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Parkinson Disease	Associate	32139796

ZNF184 (zinc finger protein 184)