RNF113A (ring finger protein 113A)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 7737
Gene name Ring finger protein 113A
Gene symbol RNF113A
Synonyms (NCBI Gene)
Cwc24RNF113TTD5ZNF183
Chromosome X
Chromosome location Xq24
Summary This intronless gene encodes a protein which contains a C3H1-type zinc finger domain and a C3HC4 Ring-type (Really Interesting New Gene-type) zinc finger domain. The Ring-type zinc finger domain is identified in various tumor suppressors, DNA repair genes
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT045195 hsa-miR-186-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (23)
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IDA 29360106
GO:0005515 Function Protein binding IPI 22365833, 28978524
GO:0005634 Component Nucleus IDA 29360106
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
300951 12974 ENSG00000125352
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15541
Protein name E3 ubiquitin-protein ligase RNF113A (EC 2.3.2.27) (Cwc24 homolog) (RING finger protein 113A) (Zinc finger protein 183)
Protein function Required for pre-mRNA splicing as component of the spliceosome (PubMed:29360106, PubMed:29361316). As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (Probable). E3 ubiquitin-protein ligase that ca
PDB 5Z56 , 5Z58 , 6FF4 , 6FF7 , 7DVQ , 7QTT , 8CH6 , 8I0R , 8I0S , 8I0T , 8I0U
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00642 zf-CCCH 197 → 223 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
PF13920 zf-C3HC4_3 259 → 306 Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9224902}.
Sequence 
MAEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKR
VTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVY
ELDTEKERDAQAIFERSQKIQEELRGKEDDKIYRGINNYQKYMKPKDTSMGNASSGMVRK
GPIRAPEHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIERELDEGR
YGVYEDENYEVGSDDEEIPFKCFICRQSFQNPVVTKCRHYFCESCALQHFRTTPRCYVCD
QQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPDEDAIPIT
Sequence length 343
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
17
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Abnormal cerebral morphology Likely pathogenic rs2147812232 RCV002275918
Trichothiodystrophy 5, nonphotosensitive Likely pathogenic; Pathogenic rs794726863, rs2521607268, rs2056406264 RCV000173011
RCV003325934
RCV001093583
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
RNF113A-related disorder Likely benign; Uncertain significance rs142377248, rs1195722629, rs774120834, rs954810120, rs2521607041, rs199657887 RCV003896030
RCV003418587
RCV003406254
RCV003419041
RCV003956604
RCV003960705
See cases Likely benign rs150591502 RCV002252362
Show/Hide Text Mining Associations (10)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 32081867
Developmental Disabilities Associate 31880405
Dry Eye Syndromes Associate 31880405
Microcephaly Associate 31880405
Myelodysplastic Syndromes Associate 15147372
Orofaciodigital syndrome 11 Associate 31880405
Seizures Associate 31880405
Small Cell Lung Carcinoma Associate 35819319
Trichothiodystrophy Syndromes Associate 30580289, 31880405
Wilms Tumor Associate 35578692