Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7726
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 26
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM26
Synonyms (NCBI Gene) Gene synonyms aliases
AFP, RNF95, ZNF173
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Altho
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023586 hsa-miR-1-3p Proteomics 18668040
MIRT1453587 hsa-miR-1 CLIP-seq
MIRT1453588 hsa-miR-1255a CLIP-seq
MIRT1453589 hsa-miR-1255b CLIP-seq
MIRT1453590 hsa-miR-206 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 21516116, 21750715, 25416956, 32296183
GO:0005634 Component Nucleus IDA 25763818
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600830 12962 ENSG00000234127
Protein
UniProt ID Q12899
Protein name Tripartite motif-containing protein 26 (EC 2.3.2.27) (Acid finger protein) (AFP) (RING finger protein 95) (Zinc finger protein 173)
Protein function E3 ubiquitin-protein ligase which regulates the IFN-beta production and antiviral response downstream of various DNA-encoded pattern-recognition receptors (PRRs). Also plays a central role in determining the response to different forms of oxidat
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15227 zf-C3HC4_4 16 56 Domain
PF00643 zf-B_box 97 138 B-box zinc finger Domain
PF13765 PRY 315 363 SPRY-associated domain Family
PF00622 SPRY 426 535 SPRY domain Family
Sequence
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHTAVLM
EKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKK
LQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
ELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVKKKTGEFSDKLLSLQRGLREF
QGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQFDCEPGVLGS
KGF
TWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG
DEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAEL
FPALRPRRVGIALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRL
LLRP
Sequence length 539
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interferon gamma signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset), Asthma (adult onset), Asthma N/A N/A GWAS
Mental Depression Major depressive disorder N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Takayasu Arteritis Takayasu arteritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 37872147
Carcinoma Hepatocellular Inhibit 36707504
Carcinoma Non Small Cell Lung Inhibit 32052576
Carcinoma Renal Cell Associate 35617983
Glioma Associate 37872147
Nasopharyngeal Carcinoma Associate 29956500
Neoplasms Associate 32052576, 35617983
Neoplasms Inhibit 37591850
Osteosarcoma Inhibit 37591850