ZNF165 (zinc finger protein 165)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7718
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 165
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF165
Synonyms (NCBI Gene) Gene synonyms aliases
CT53, LD65, ZSCAN7
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the Kruppel family of zinc finger proteins. Members of this DNA-binding protein family act as transcriptional regulators. This gene is located within a cluster of zinc finger family members. The encoded protein may play a rol
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT024922 hsa-miR-215-5p Microarray 19074876
MIRT026191 hsa-miR-192-5p Microarray 19074876
MIRT1517032 hsa-miR-1238 CLIP-seq
MIRT1517033 hsa-miR-4310 CLIP-seq
MIRT1517034 hsa-miR-4699-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0005515 Function Protein binding IPI 16189514, 25910212, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IEA
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
600834 12953 ENSG00000197279
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID P49910
Protein name Zinc finger protein 165 (Cancer/testis antigen 53) (CT53) (LD65) (Zinc finger and SCAN domain-containing protein 7)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 45 → 134 SCAN domain Domain
PF00096 zf-C2H2 344 → 366 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 372 → 394 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 400 → 422 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 428 → 450 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 456 → 478 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in testis.
Sequence 
MATEPKKAAAQNSPEDEGLLIVKIEEEEFIHGQDTCLQRSELLKQELCRQLFRQFCYQDS
PGPREALSRLRELCCQWLKPEIHTKEQILELLVLEQFLTILPGDLQAWVHEHYPESGEEA
VTILEDLERGTDEAVLQVQAHEHGQEIFQKKVSPPGPALNVKLQPVETKAHFDSSEPQLL
WDCDNESENSRSMPKLEIFEKIESQRIISGRISGYISEASGESQDICKSAGRVKRQWEKE
SGESQRLSSAQDEGFGKILTHKNTVRGEIISHDGCERRLNLNSNEFTHQKSCKHGTCDQS
FKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAAVFSGDKTHQCNECGKAFRHSSKLA
RHQRIHTGERCYECNECGKSFAESSDLTRHRRIHTGERPFGCKECGRAFNLNSHLIRHQR
IHTREKPYECSECGKTFRVSSHLIRHFRIHTGEKPYECSECGRAFSQSSNLSQHQRIHMR
ENLLM
Sequence length 485
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Parkinson disease Parkinson Disease rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432
View all (84 more)		 28892059
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Coronary heart disease Coronary heart disease 21971053 ClinVar
Parkinson Disease Parkinson Disease GWAS
Show/Hide Text Mining Associations (10)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 15354214, 35692498
Carcinoma Non Small Cell Lung Associate 15354214
Carcinoma Transitional Cell Associate 25214475
Hemochromatosis Associate 18990219
Neoplasms Associate 15354214, 16929165
NOG Related Symphalangism Spectrum Disorder Associate 25214475
Non Muscle Invasive Bladder Neoplasms Associate 25214475
Pulmonary Disease Chronic Obstructive Associate 22621770
Stomach Neoplasms Associate 35974335
Testicular Neoplasms Associate 15354214