Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7704
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger and BTB domain containing 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZBTB16
Synonyms (NCBI Gene) Gene synonyms aliases
PLZF, ZNF145
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q23.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121434606 A>G Pathogenic Coding sequence variant, genic downstream transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT718189 hsa-miR-6849-3p HITS-CLIP 19536157
MIRT718188 hsa-miR-361-3p HITS-CLIP 19536157
MIRT718187 hsa-miR-3162-3p HITS-CLIP 19536157
MIRT718186 hsa-miR-6778-3p HITS-CLIP 19536157
MIRT707766 hsa-miR-5011-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10688654, 12802276
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10688654, 12802276
GO:0001222 Function Transcription corepressor binding IPI 10688654
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
176797 12930 ENSG00000109906
Protein
UniProt ID Q05516
Protein name Zinc finger and BTB domain-containing protein 16 (Promyelocytic leukemia zinc finger protein) (Zinc finger protein 145) (Zinc finger protein PLZF)
Protein function Acts as a transcriptional repressor (PubMed:10688654, PubMed:24359566). Transcriptional repression may be mediated through recruitment of histone deacetylases to target promoters (PubMed:10688654). May play a role in myeloid maturation and in th
PDB 1BUO , 1CS3 , 8YTH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00651 BTB 24 126 BTB/POZ domain Domain
PF13912 zf-C2H2_6 460 485 Domain
PF00096 zf-C2H2 491 512 Zinc finger, C2H2 type Domain
PF13912 zf-C2H2_6 517 542 Domain
PF00096 zf-C2H2 546 568 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 574 596 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Within the hematopoietic system, PLZF is expressed in bone marrow, early myeloid cell lines and peripheral blood mononuclear cells. Also expressed in the ovary, and at lower levels, in the kidney and lung.
Sequence
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
MLETIQ
ASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTG
TDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TG
DHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
Sequence length 673
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
  Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Paneth cell defects in Crohn's disease N/A N/A GWAS
Polycystic Ovary Syndrome Polycystic ovary syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aberrant Crypt Foci Associate 24348178
Adenocarcinoma of Lung Associate 32998690
Adenoma Associate 24990570
Adenomatous Polyposis Coli Associate 24990570
Aortic Aneurysm Abdominal Associate 29439675
Ataxia Telangiectasia Associate 22555178
Bone Marrow Diseases Associate 22555178
Breast Neoplasms Associate 26070530, 37902007
Carcinogenesis Associate 24348178, 25807461, 25990457, 33414372
Carcinoma Renal Cell Associate 36530957