Gene Gene information from NCBI Gene database.
Entrez ID 7703
Gene name Polycomb group ring finger 2
Gene symbol PCGF2
Synonyms (NCBI Gene)
MEL-18RNF110TPFSZNF144
Chromosome 17
Chromosome location 17q12
Summary The protein encoded by this gene contains a RING finger motif and is similar to the polycomb group (PcG) gene products. PcG gene products form complexes via protein-protein interaction and maintain the transcription repression of genes involved in embryog
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs1567941252 G>A Likely-pathogenic Missense variant, coding sequence variant
rs1567941256 G>A Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
421
miRTarBase ID miRNA Experiments Reference
MIRT028183 hsa-miR-33a-5p Sequencing 20371350
MIRT038479 hsa-miR-296-3p CLASH 23622248
MIRT707979 hsa-miR-202-5p HITS-CLIP 21572407
MIRT076947 hsa-miR-548aa HITS-CLIP 21572407
MIRT076951 hsa-miR-548ap-3p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 19636380
GO:0000785 Component Chromatin IDA 19636380
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600346 12929 ENSG00000277258
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P35227
Protein name Polycomb group RING finger protein 2 (DNA-binding protein Mel-18) (RING finger protein 110) (Zinc finger protein 144)
Protein function Transcriptional repressor. Binds specifically to the DNA sequence 5'-GACTNGACT-3'. Has tumor suppressor activity. May play a role in control of cell proliferation and/or neural cell development. Regulates proliferation of early T progenitor cell
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13923 zf-C3HC4_2 17 56 Domain
PF16207 RAWUL 164 228 RAWUL domain RING finger- and WD40-associated ubiquitin-like Domain
Tissue specificity TISSUE SPECIFICITY: Detected in all tissues examined with high expression found in placenta lung and kidney and low expression, in liver, pancreas and skeletal muscle.
Sequence
MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQV
HKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQ
EKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKF
LRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYR
VQPACKRLTLAT
VPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSP
TPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT
Sequence length 344
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Polycomb repressive complex
Signaling pathways regulating pluripotency of stem cells
  SUMOylation of DNA damage response and repair proteins
SUMOylation of transcription cofactors
SUMOylation of chromatin organization proteins
SUMOylation of RNA binding proteins
Transcriptional Regulation by E2F6
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
30
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Abnormality of the outer ear Likely pathogenic; Pathogenic rs1567941252 RCV000758165
Global developmental delay Likely pathogenic; Pathogenic rs1567941252 RCV001255407
Intellectual disability Likely pathogenic; Pathogenic rs1567941252 RCV000758165
Turnpenny-fry syndrome Likely pathogenic; Pathogenic rs1567941252, rs1567941256 RCV000766184
RCV000766185
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Uncertain significance rs1906972407 RCV005925458
PCGF2-related disorder Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance rs1138349, rs146768937, rs2075057, rs72819704, rs2230090, rs143182107, rs560971855, rs369222947, rs759495717, rs139456880, rs1164566149, rs991646402, rs182900980, rs377749543 RCV003976179
RCV003911301
RCV003973324
RCV003978677
RCV003923678
RCV003903390
RCV004741259
RCV004741452
RCV004741335
RCV003961285
RCV004741434
RCV003397288
RCV003929086
RCV003951936
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 17545584, 18519679, 20170541, 21162745, 23260012, 36123926
Breast Neoplasms Inhibit 20444850
Carcinogenesis Associate 20170541, 21059209, 24964959
Colorectal Neoplasms Associate 24964959
Hereditary leiomyomatosis and renal cell cancer Associate 14982841, 26160878
Hypoxia Brain Stimulate 26160878
Leukemia Monocytic Acute Associate 10765922
Lymphatic Metastasis Inhibit 21059209
Lymphoma B Cell Associate 23948956
Medulloblastoma Associate 20717685