ZNF143 (zinc finger protein 143)

Gene

• Entrez ID: 7702
• Gene name: Zinc finger protein 143
• Gene symbol: ZNF143
• Synonyms (NCBI Gene): SBF, STAF, pHZ-1
• Chromosome: 11
• Chromosome location: 11p15.4

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028153	hsa-miR-93-5p	Sequencing	20371350
MIRT1516629	hsa-miR-135a	CLIP-seq
MIRT1516630	hsa-miR-135b	CLIP-seq
MIRT1516631	hsa-miR-2117	CLIP-seq
MIRT1516632	hsa-miR-3119	CLIP-seq
MIRT1516633	hsa-miR-3140-3p	CLIP-seq
MIRT1516634	hsa-miR-3153	CLIP-seq
MIRT1516635	hsa-miR-365	CLIP-seq
MIRT1516636	hsa-miR-3662	CLIP-seq
MIRT1516637	hsa-miR-3673	CLIP-seq
MIRT1516638	hsa-miR-380	CLIP-seq
MIRT1516639	hsa-miR-4273	CLIP-seq
MIRT1516640	hsa-miR-4639-3p	CLIP-seq
MIRT1516641	hsa-miR-4668-5p	CLIP-seq
MIRT1516642	hsa-miR-4760-3p	CLIP-seq
MIRT1516643	hsa-miR-515-5p	CLIP-seq
MIRT2155934	hsa-miR-4694-3p	CLIP-seq
MIRT1516642	hsa-miR-4760-3p	CLIP-seq
MIRT2155935	hsa-miR-4775	CLIP-seq
MIRT2155936	hsa-miR-548c-3p	CLIP-seq
MIRT2155937	hsa-miR-590-3p	CLIP-seq
MIRT2375595	hsa-miR-3923	CLIP-seq
MIRT2375596	hsa-miR-580	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	10893243
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10893243
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	17938208, 32296183, 33961781, 34819669
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	9566884
GO:0006359	Process	Regulation of transcription by RNA polymerase III	IEA
GO:0006359	Process	Regulation of transcription by RNA polymerase III	TAS	9566884
GO:0008270	Function	Zinc ion binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	EXP	9009278
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10893243
GO:0045945	Process	Positive regulation of transcription by RNA polymerase III	TAS	9009278
GO:0046872	Function	Metal ion binding	IEA
GO:1905382	Process	Positive regulation of snRNA transcription by RNA polymerase II	EXP	9009278

Other IDs

• MIM: 603433
• HGNC: 12928
• e!Ensembl: ENSG00000166478

Protein

• UniProt ID: P52747
• Protein name: Zinc finger protein 143 (SPH-binding factor) (Selenocysteine tRNA gene transcription-activating factor) (hStaf)
• Protein function: Transcriptional activator. Activates the gene for selenocysteine tRNA (tRNAsec). Binds to the SPH motif of small nuclear RNA (snRNA) gene promoters. Participates in efficient U6 RNA polymerase III transcription via its interaction with CHD8. In
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	237 → 261	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	267 → 291	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	297 → 321	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	357 → 381	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	417 → 440	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in all tissues tested, with the strongest expression in ovary.
• Sequence:

  MLLAQINRDSQGMTEFPGGGMEAQHVTLCLTEAVTVADGDNLENMEGVSLQAVTLADGST
  AYIQHNSKDAKLIDGQVIQLEDGSAAYVQHVPIPKSTGDSLRLEDGQAVQLEDGTTAFIH
  HTSKDSYDQSALQAVQLEDGTTAYIHHAVQVPQSDTILAIQADGTVAGLHTGDATIDPDT
  ISALEQYAAKVSIDGSESVAGTGMIGENEQEKKMQIVLQGHATRVTAKSQQSGEKAFRCE
  YDGCGKLYTTAHHLKVHERSHTGDRPYQCEHAGCGKAFATGYGLKSHVRTHTGEKPYRCS
  EDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHVRTHTGERPYYCT
  EPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCN
  HCGKTYKQISTLAMHKRTAHNDTEPIEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDD
  VVSTQVATVTQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDA
  VISSAGTHSVAMVTAEGTEGEQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLV
  ATSNGTQIAVQLGEQPSLEEAIRIASRIQQGETPGLDD

• Sequence length: 638

Pathways

KEGG:

Cobalamin transport and metabolism

Reactome:

RNA polymerase II transcribes snRNA genes
RNA Polymerase III Transcription Initiation From Type 3 Promoter

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disorders of Intracellular Cobalamin Metabolism	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METHYLMALONIC ACIDEMIA WITH HOMOCYSTINURIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METHYLMALONIC ACIDURIA AND HOMOCYSTINURIA	—	ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ZNF143-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	24736586, 35068350, 37158648	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Stimulate	35400998	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	29065970, 30935019	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	20733350	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	39488269	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	35400998	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Stimulate	35400998	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	20733350, 21909943, 30933430	★☆☆☆☆ Found in Text Mining only
Epilepsy	Associate	37246165	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	37423952	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	20860770	★☆☆☆☆ Found in Text Mining only
Methylmalonic acidemia with homocystinuria	Associate	34655177	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Associate	23152058	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	20733350, 39488269	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	20860770, 24736586, 29065970, 30933430, 35400998, 37423952	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	30885238	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	20860770	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Stimulate	35400998	★☆☆☆☆ Found in Text Mining only
Respiratory System Abnormalities	Associate	23152058	★☆☆☆☆ Found in Text Mining only