ZNF141 (zinc finger protein 141)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7700
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 141
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF141
Synonyms (NCBI Gene) Gene synonyms aliases
D4S90, pHZ-44
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p16.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a zinc finger protein that may be a tumor suppressor. Defects in this gene have been associated with autosomal recessive postaxial polydactyly type A. [provided by RefSeq, Jan 2017]
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
SNP ID Visualize variation Clinical significance Consequence
rs587776959 C>T Pathogenic-likely-pathogenic Genic downstream transcript variant, missense variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(70)
miRTarBase ID miRNA Experiments Reference
MIRT028830 hsa-miR-26b-5p Microarray 19088304
MIRT650461 hsa-miR-6808-5p HITS-CLIP 23824327
MIRT650460 hsa-miR-6893-5p HITS-CLIP 23824327
MIRT650459 hsa-miR-940 HITS-CLIP 23824327
MIRT650458 hsa-miR-3929 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 7649249
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
194648 12926 ENSG00000131127
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q15928
Protein name Zinc finger protein 141
Protein function May be involved in transcriptional regulation as a repressor. Plays a role in limb development.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 3 → 44 KRAB box Family
PF00096 zf-C2H2 227 → 249 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 255 → 277 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 283 → 305 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 311 → 333 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 339 → 361 Zinc finger, C2H2 type Domain
PF13912 zf-C2H2_6 367 → 392 Domain
PF00096 zf-C2H2 395 → 417 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 423 → 445 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 451 → 473 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously low expression.
Sequence 
MELLTFRDVAIEFSPEEWKCLDPDQQNLYRDVMLENYRNLVSLGVAISNPDLVTCLEQRK
EPYNVKIHKIVARPPAMCSHFTQDHWPVQGIEDSFHKLILRRYEKCGHDNLQLRKGCKSL
NECKLQKGGYNEFNECLSTTQSKILQCKASVKVVSKFSNSNKRKTRHTGEKHFKECGKSF
QKFSHLTQHKVIHAGEKPYTCEECGKAFKWSLIFNEHKRIHTGEKPFTCEECGSIFTTSS
HFAKHKIIHTGEKPYKCEECGKAFNRFTTLTKHKRIHAGEKPITCEECRKIFTSSSNFAK
HKRIHTGEKPYKCEECGKAFNRSTTLTKHKRIHTGEKPYTCEECGKAFRQSSKLNEHKKV
HTGERPYKCDECGKAFGRSRVLNEHKKIHTGEKPYKCEECGKAFRRSTDRSQHKKIHSAD
KPYKCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIHT
Sequence length 474
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Polydactyly polydactyly, postaxial, type a6 rs587776959 N/A
Show/Hide Text Mining Associations (5)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Intestinal Diseases Associate 17071588
Lymphoma Extranodal NK T Cell Associate 34872521
Neoplasms Associate 34738870
Polydactyly Associate 28488682, 31115189
Wolf Hirschhorn Syndrome Associate 32416892