ZNF138 (zinc finger protein 138)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 7697
Gene name Zinc finger protein 138
Gene symbol ZNF138
Synonyms (NCBI Gene)
pHZ-32
Chromosome 7
Chromosome location 7q11.21
miRNA miRNA information provided by mirtarbase database.
715
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (715)
miRTarBase ID miRNA Experiments Reference
MIRT690679 hsa-miR-670-3p HITS-CLIP 23313552
MIRT452907 hsa-miR-3944-5p HITS-CLIP 23313552
MIRT452906 hsa-miR-143-5p HITS-CLIP 23313552
MIRT526735 hsa-miR-181a-2-3p HITS-CLIP 23706177
MIRT526734 hsa-miR-1273g-3p HITS-CLIP 23706177
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (9)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 31403225, 32296183, 32814053
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604080 12922 ENSG00000197008
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P52744
Protein name Zinc finger protein 138
Protein function May be involved in transcriptional regulation as a repressor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 194 → 216 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 222 → 243 Zinc finger, C2H2 type Domain
Sequence 
MKRHEMVVAKHSALCSRFAQDLWLEQNIKDSFQKVTLSRYGKYGHKNLQLRKGCKSVDEC
KGHQGGFNGLNQCLKITTSKIFQCNKYVKVMHKFSNSNRHKIRHTENKHFRCKECDKSLC
MLSRLTQHKKIHTRENFYKCEECGKTFNWSTNLSKPKKIHTGEKPYKCEVCGKAFHQSSI
LTKHKIIRTGEKPYKCAHCGKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKH
QIIYTGEEPYKCEECGKAFNLS
Sequence length 262
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
HYPERTENSION — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations