ZNF133 (zinc finger protein 133)

Gene

• Entrez ID: 7692
• Gene name: Zinc finger protein 133
• Gene symbol: ZNF133
• Synonyms (NCBI Gene): ZNF150, pHZ-13, pHZ-66
• Chromosome: 20
• Chromosome location: 20p11.23

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029486	hsa-miR-26b-5p	Microarray	19088304
MIRT1516355	hsa-miR-105	CLIP-seq
MIRT1516356	hsa-miR-132	CLIP-seq
MIRT1516357	hsa-miR-212	CLIP-seq
MIRT1516358	hsa-miR-30a	CLIP-seq
MIRT1516359	hsa-miR-30b	CLIP-seq
MIRT1516360	hsa-miR-30c	CLIP-seq
MIRT1516361	hsa-miR-30d	CLIP-seq
MIRT1516362	hsa-miR-30e	CLIP-seq
MIRT1516363	hsa-miR-3121-5p	CLIP-seq
MIRT1516355	hsa-miR-105	CLIP-seq
MIRT1516356	hsa-miR-132	CLIP-seq
MIRT1516357	hsa-miR-212	CLIP-seq
MIRT1516363	hsa-miR-3121-5p	CLIP-seq
MIRT2441810	hsa-miR-3152-5p	CLIP-seq
MIRT2441811	hsa-miR-4540	CLIP-seq
MIRT2441812	hsa-miR-4646-3p	CLIP-seq
MIRT2441813	hsa-miR-4774-3p	CLIP-seq
MIRT2441810	hsa-miR-3152-5p	CLIP-seq
MIRT2441811	hsa-miR-4540	CLIP-seq
MIRT2441812	hsa-miR-4646-3p	CLIP-seq
MIRT2441813	hsa-miR-4774-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	7649249
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9278146
GO:0005515	Function	Protein binding	IPI	20195357, 25416956
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 604075
• HGNC: 12917
• e!Ensembl: ENSG00000125846

Protein

• UniProt ID: P52736
• Protein name: Zinc finger protein 133 (Zinc finger protein 150)
• Protein function: May be involved in transcriptional regulation as a repressor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01352	KRAB	1 → 41	KRAB box	Family
  PF00096	zf-C2H2	214 → 236	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	242 → 264	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	270 → 292	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	298 → 320	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	326 → 348	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	354 → 376	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	382 → 404	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	410 → 432	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	438 → 460	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	466 → 488	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	494 → 516	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	522 → 544	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	606 → 631	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Seems ubiquitous. Seen in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
• Sequence:

  MAFRDVAVDFTQDEWRLLSPAQRTLYREVMLENYSNLVSLGISFSKPELITQLEQGKETW
  REEKKCSPATCPADPEPELYLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCAEGNIQPG
  DPGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLGAFSRPPQRQPVSSRNG
  LRGVELEASPAQSGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLLSHQRIHSGEK
  PYVCGVCEKGFSLKKSLARHQKAHSGEKPIVCRECGRGFNRKSTLIIHERTHSGEKPYMC
  SECGRGFSQKSNLIIHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCSDCG
  LGFSDRSNLISHQRTHSGEKPYACKECGRCFRQRTTLVNHQRTHSKEKPYVCGVCGHSFS
  QNSTLISHRRTHTGEKPYVCGVCGRGFSLKSHLNRHQNIHSGEKPIVCKDCGRGFSQQSN
  LIRHQRTHSGEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCRECGRGFSHQAGLIRH
  KRKHSREKPYMCRQCGLGFGNKSALITHKRAHSEEKPCVCRECGQGFLQKSHLTLHQMTH
  TGEKPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPCAGQPSDSLYSL

• Sequence length: 654

Pathways

Reactome:

Generic Transcription Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Asthma	Associate	37466093	★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Posterior Polymorphous 1	Associate	23049806	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	32577795	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	37466093	★☆☆☆☆ Found in Text Mining only
von Willebrand Disease Type 2	Associate	32577795	★☆☆☆☆ Found in Text Mining only