Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7627
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 75A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF75A
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT549646 hsa-miR-508-5p PAR-CLIP 21572407
MIRT549644 hsa-miR-4293 PAR-CLIP 21572407
MIRT549645 hsa-miR-25-3p PAR-CLIP 21572407
MIRT549643 hsa-miR-32-5p PAR-CLIP 21572407
MIRT549642 hsa-miR-363-3p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA 21873635
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IBA 21873635
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601473 13146 ENSG00000162086
Protein
UniProt ID Q96N20
Protein name Zinc finger protein 75A
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 1 33 KRAB box Family
PF00096 zf-C2H2 161 183 Zinc finger, C2H2 type Domain
PF13912 zf-C2H2_6 189 214 Domain
PF00096 zf-C2H2 217 239 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 245 267 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 273 295 Zinc finger, C2H2 type Domain
Sequence
MYFSQEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQVSPE
FKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMH
RVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFKCQECGKTFRVSSDLIKHQ
RIH
TEEKPYKCQQCDKRFRWSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHT
GEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHL
Sequence length 296
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)