Gene Gene information from NCBI Gene database.
Entrez ID 7627
Gene name Zinc finger protein 75A
Gene symbol ZNF75A
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16p13.3
miRNA miRNA information provided by mirtarbase database.
114
miRTarBase ID miRNA Experiments Reference
MIRT549646 hsa-miR-508-5p PAR-CLIP 21572407
MIRT549644 hsa-miR-4293 PAR-CLIP 21572407
MIRT549645 hsa-miR-25-3p PAR-CLIP 21572407
MIRT549643 hsa-miR-32-5p PAR-CLIP 21572407
MIRT549642 hsa-miR-363-3p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601473 13146 ENSG00000162086
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96N20
Protein name Zinc finger protein 75A
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 1 33 KRAB box Family
PF00096 zf-C2H2 161 183 Zinc finger, C2H2 type Domain
PF13912 zf-C2H2_6 189 214 Domain
PF00096 zf-C2H2 217 239 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 245 267 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 273 295 Zinc finger, C2H2 type Domain
Sequence
MYFSQEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQVSPE
FKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMH
RVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFKCQECGKTFRVSSDLIKHQ
RIH
TEEKPYKCQQCDKRFRWSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHT
GEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHL
Sequence length 296
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway