Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Transcription factors Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	7593
Gene name Gene Name - the full gene name approved by the HGNC.	Myeloid zinc finger 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MZF1
Synonyms (NCBI Gene) Gene synonyms aliases	MZF-1, MZF1B, ZFP98, ZNF42, ZSCAN6
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.43

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
MYB	Unknown	7565760

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	7579328
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	15541732
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	7579328
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	7579328
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	7579328
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	1860835
GO:0005515	Function	Protein binding	IPI	10777584
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	15541732
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	1860835
GO:0008270	Function	Zinc ion binding	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	16950398
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7579328
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
194550	13108	ENSG00000099326

Protein

UniProt ID

P28698

Protein name

Myeloid zinc finger 1 (MZF-1) (Zinc finger and SCAN domain-containing protein 6) (Zinc finger protein 42)

Protein function

Binds to target promoter DNA and functions as a transcription regulator. Regulates transcription from the PADI1 and CDH2 promoter. May be one regulator of transcriptional events during hemopoietic development. {ECO:0000269|PubMed:15541732, ECO:0

PDB

2FI2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02023	SCAN	40 → 129	SCAN domain	Domain
PF00096	zf-C2H2	357 → 378	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	384 → 406	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	412 → 434	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	440 → 462	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	541 → 563	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	569 → 591	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	597 → 619	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	625 → 647	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	653 → 675	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	681 → 703	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	709 → 731	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Preferentially expressed in differentiating myeloid cells. Detected in osteoblasts. {ECO:0000269|PubMed:15541732}.

Sequence

MRPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFRYEEATGPQE
ALAQLRELCRQWLRPEVRSKEQMLELLVLEQFLGALPPEIQARVQGQRPGSPEEAAALVD
GLRREPGGPRRWVTVQVQGQEVLSEKMEPSSFQPLPETEPPTPEPGPKTPPRTMQESPLG
LQVKEESEVTEDSDFLESGPLAATQESVPTLLPEEAQRCGTVLDQIFPHSKTGPEGPSWR
EHPRALWHEEAGGIFSPGFALQLGSISAGPGSVSPHLHVPWDLGMAGLSGQIQSPSREGG
FAHALLLPSDLRSEQDPTDEDPCRGVGPALITTRWRSPRGRSRGRPSTGGGVVRGGRCDV
CGKVFSQRSNLLRHQKIHTGERPFVCSECGRSFSRSSHLLRHQLTHTEERPFVCGDCGQG
FVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGAKPPAPPGAPE
PPGPFPCSECRESFARRAVLLEHQAVHTGDKSFGCVECGERFGRRSVLLQHRRVHSGERP
FACAECGQSFRQRSNLTQHRRIHTGERPFACAECGKAFRQRPTLTQHLRVHTGEKPFACP
ECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQ
SFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQ
STKLIQHQRVHSAE

Sequence length

734

Interactions

View interactions

MZF1 (myeloid zinc finger 1)