ZNF32 (zinc finger protein 32)

Gene

• Entrez ID: 7580
• Gene name: Zinc finger protein 32
• Gene symbol: ZNF32
• Synonyms (NCBI Gene): KOX30, ZNF637, Zfp637
• Chromosome: 10
• Chromosome location: 10q11.21

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1521983	hsa-miR-3148	CLIP-seq
MIRT1521984	hsa-miR-3153	CLIP-seq
MIRT1521985	hsa-miR-3157-3p	CLIP-seq
MIRT1521986	hsa-miR-4328	CLIP-seq
MIRT1521987	hsa-miR-548c-3p	CLIP-seq
MIRT1521988	hsa-miR-874	CLIP-seq
MIRT2464204	hsa-miR-1276	CLIP-seq
MIRT2464205	hsa-miR-146a	CLIP-seq
MIRT2464206	hsa-miR-146b-5p	CLIP-seq
MIRT2464207	hsa-miR-3925-5p	CLIP-seq
MIRT2464208	hsa-miR-4311	CLIP-seq
MIRT2464209	hsa-miR-4760-3p	CLIP-seq
MIRT2464210	hsa-miR-583	CLIP-seq
MIRT2464211	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 194539
• HGNC: 13095
• e!Ensembl: ENSG00000169740

Protein

• UniProt ID: P17041
• Protein name: Zinc finger protein 32 (C2H2-546) (Zinc finger protein KOX30)
• Protein function: May be involved in transcriptional regulation.
• PDB: 2EPC, 2EPT, 2EPU, 2YTA, 2YTB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	77 → 99	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	105 → 127	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	133 → 155	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	161 → 183	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	189 → 211	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	245 → 266	Zinc finger, C2H2 type	Domain

• Sequence:

  MFGFPTATLLDCHGRYAQNVAFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSP
  DSKTLQEDSPGVRQRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNL
  VTHQRIHTGEKPYQCKECGKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHR
  RVHSGEKPYRCDQCGKAFSQKGSLIVHIRVHTGLKPYACTQCRKSFHTRGNCILHGKIHT
  GETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL

• Sequence length: 273

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MALE INFERTILITY DUE TO CHROMOSOME Y MICRODELETION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma	Associate	27763636	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	27763636	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	35115495	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	38199212	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	35115495	★☆☆☆☆ Found in Text Mining only
Disease Resistance	Stimulate	27763636	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	33155203	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	27763636	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	33155203	★☆☆☆☆ Found in Text Mining only
Tuberculosis Multidrug Resistant	Stimulate	27763636	★☆☆☆☆ Found in Text Mining only