Gene Gene information from NCBI Gene database.
Entrez ID 7572
Gene name Zinc finger protein 24
Gene symbol ZNF24
Synonyms (NCBI Gene)
KOX17RSG-AZNF191ZSCAN3Zfp191
Chromosome 18
Chromosome location 18q12.2
miRNA miRNA information provided by mirtarbase database.
923
miRTarBase ID miRNA Experiments Reference
MIRT708296 hsa-miR-892b HITS-CLIP 19536157
MIRT708295 hsa-miR-576-3p HITS-CLIP 19536157
MIRT708294 hsa-miR-6760-3p HITS-CLIP 19536157
MIRT708293 hsa-miR-1245b-3p HITS-CLIP 19536157
MIRT708292 hsa-miR-6887-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 11532988
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
194534 13032 ENSG00000172466
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P17028
Protein name Zinc finger protein 24 (Retinoic acid suppression protein A) (RSG-A) (Zinc finger and SCAN domain-containing protein 3) (Zinc finger protein 191) (Zinc finger protein KOX17)
Protein function Transcription factor required for myelination of differentiated oligodendrocytes. Required for the conversion of oligodendrocytes from the premyelinating to the myelinating state. In the developing central nervous system (CNS), involved in the m
PDB 1X6E , 3LHR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 48 137 SCAN domain Domain
PF00096 zf-C2H2 251 273 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 279 301 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 307 329 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 335 357 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in many tissues except in heart.
Sequence
MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFRQRFRQFGY
QDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVRDHHPENG
EEAVTVLEDLESELDDP
GQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWAS
WELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFE
RKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRV
H
TGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAE
KLLNVVKV
Sequence length 368
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
COLOR VISION DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Breast Neoplasms Associate 25550468
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 33197287, 35092191
★☆☆☆☆
Found in Text Mining only
Glioblastoma Associate 30628650
★☆☆☆☆
Found in Text Mining only
Glucosephosphate Dehydrogenase Deficiency Associate 25550468
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 19463170, 23025254
★☆☆☆☆
Found in Text Mining only
Neoplasms Inhibit 25550468
★☆☆☆☆
Found in Text Mining only
Obesity Associate 38127891
★☆☆☆☆
Found in Text Mining only
Osteoarthritis Associate 38127891
★☆☆☆☆
Found in Text Mining only
Stomach Neoplasms Associate 26317898
★☆☆☆☆
Found in Text Mining only
Williams Syndrome Associate 23545495
★☆☆☆☆
Found in Text Mining only