Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7567
Gene name	Zinc finger protein 19
Gene symbol	ZNF19
Synonyms (NCBI Gene)	KOX12
Chromosome	16
Chromosome location	16q22.2
Summary	The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16. [provided by RefSeq

Show/Hide all (37)

miRTarBase ID	miRNA	Experiments
MIRT1517537	hsa-miR-208a	CLIP-seq
MIRT1517538	hsa-miR-208b	CLIP-seq
MIRT1517539	hsa-miR-3674	CLIP-seq
MIRT1517540	hsa-miR-4432	CLIP-seq
MIRT1517541	hsa-miR-4775	CLIP-seq
MIRT1517542	hsa-miR-499-5p	CLIP-seq
MIRT1517543	hsa-miR-526b	CLIP-seq
MIRT1517544	hsa-miR-578	CLIP-seq
MIRT1517545	hsa-miR-580	CLIP-seq
MIRT1517546	hsa-miR-590-3p	CLIP-seq
MIRT2375823	hsa-miR-1246	CLIP-seq
MIRT2375824	hsa-miR-4320	CLIP-seq
MIRT2375825	hsa-miR-4420	CLIP-seq
MIRT1517545	hsa-miR-580	CLIP-seq
MIRT2397448	hsa-miR-216a	CLIP-seq
MIRT2668302	hsa-miR-1268	CLIP-seq
MIRT2668303	hsa-miR-1268b	CLIP-seq
MIRT2668304	hsa-miR-1972	CLIP-seq
MIRT2668305	hsa-miR-3126-5p	CLIP-seq
MIRT2668306	hsa-miR-3134	CLIP-seq
MIRT2668307	hsa-miR-383	CLIP-seq
MIRT2668308	hsa-miR-3913-3p	CLIP-seq
MIRT2668309	hsa-miR-3929	CLIP-seq
MIRT2668310	hsa-miR-4257	CLIP-seq
MIRT2668311	hsa-miR-4318	CLIP-seq
MIRT2668312	hsa-miR-4419a	CLIP-seq
MIRT2668313	hsa-miR-4419b	CLIP-seq
MIRT2668314	hsa-miR-4427	CLIP-seq
MIRT2668315	hsa-miR-4474-3p	CLIP-seq
MIRT2668316	hsa-miR-4478	CLIP-seq
MIRT2668317	hsa-miR-4510	CLIP-seq
MIRT2668318	hsa-miR-4650-5p	CLIP-seq
MIRT2668319	hsa-miR-4680-3p	CLIP-seq
MIRT2668320	hsa-miR-485-5p	CLIP-seq
MIRT2668321	hsa-miR-489	CLIP-seq
MIRT2668322	hsa-miR-626	CLIP-seq
MIRT2668323	hsa-miR-676	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
194525	12981	ENSG00000157429

P17023

Protein name

Zinc finger protein 19 (Zinc finger protein KOX12)

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	13 → 54	KRAB box	Family
PF00096	zf-C2H2	161 → 183	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	189 → 211	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	217 → 239	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	245 → 267	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	273 → 295	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	301 → 323	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	329 → 351	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	357 → 379	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	385 → 407	Zinc finger, C2H2 type	Domain

Sequence

MAAMPLKAQYQEMVTFEDVAVHFTKTEWTGLSPAQRALYRSVMLENFGNLTALGYPVPKP
ALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSESTLIQGISEERDGMMSHGQL
KSVPQRTDFPETRNVEKHQDIPTVKNIQGKVPRIPCARKPFICEECGKSFSYFSYYARHQ
RIHTGEKPFECSECGKAFNGNSSLIRHQRIHTGERPYQCEECGRAFNDNANLIRHQRIHS
GDRPYYCTECGNSFTSSSEFVIHQRIHTGEKPYECNECGKAFVGNSPLLRHQKIHTGEKP
YECNECGKSFGRTSHLSQHQRIHTGEKPYSCKVCGQAFNFHTKLTRHQRIHSEEKPFDCV
DCGKAFSAQEQLKRHLRIHTQESSYVCDECGKALTSKRNLHQHQRIHTGEKPYECSKYEK
AFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW

Sequence length

458

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ZNF19 (zinc finger protein 19)