Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
7546
Gene name Gene Name - the full gene name approved by the HGNC.
Zic family zinc finger 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZIC2
Synonyms (NCBI Gene) Gene synonyms aliases
HPE5
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q32.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This protein functions as a transcriptional repressor and may regulate tissue specific expression of dopamine receptor D1. Expansion of an alanine repeat in the C-terminus of
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs397515364 ->C Pathogenic Coding sequence variant, frameshift variant
rs397515365 GAGAACC>- Pathogenic Coding sequence variant, frameshift variant
rs397515499 G>- Pathogenic Coding sequence variant, frameshift variant
rs397515500 AG>- Pathogenic Coding sequence variant, frameshift variant
rs753776168 C>G,T Pathogenic Stop gained, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT048739 hsa-miR-93-5p CLASH 23622248
MIRT044573 hsa-miR-320a CLASH 23622248
MIRT618798 hsa-miR-548ae-3p HITS-CLIP 23824327
MIRT618797 hsa-miR-548ah-3p HITS-CLIP 23824327
MIRT618796 hsa-miR-548aj-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0003677 Function DNA binding ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603073 12873 ENSG00000043355
Protein
UniProt ID O95409
Protein name Zinc finger protein ZIC 2 (Zinc finger protein of the cerebellum 2)
Protein function Acts as a transcriptional activator or repressor. Plays important roles in the early stage of organogenesis of the CNS. Activates the transcription of the serotonin transporter SERT in uncrossed ipsilateral retinal ganglion cells (iRGCs) to refi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18366 zf_ZIC 248 295 Zic proteins zinc finger domain Domain
PF00096 zf-C2H2 333 357 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 363 387 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 393 415 Zinc finger, C2H2 type Domain
Sequence
MLLDAGPQFPAIGVGSFARHHHHSAAAAAAAAAEMQDRELSLAAAQNGFVDSAAAHMGAF
KLNPGAHELSPGQSSAFTSQGPGAYPGSAAAAAAAAALGPHAAHVGSYSGPPFNSTRDFL
FRSRGFGDSAPGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMR
LGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMNMGMNMAAAAAHHHHHHHHHP
GAFFRYMRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNH
VCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGE
KPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSPQ
GSESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGGS
GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSGLSSNFNEWYV
Sequence length 532
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Holoprosencephaly holoprosencephaly 5 rs397515499, rs1566405714, rs397515500, rs1594291863, rs794729641, rs1594292057, rs1060499564, rs2053256914, rs1060499563, rs1060499562, rs1555332362, rs397515364, rs1555332361, rs397515365, rs756225250
View all (4 more)
N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32819300
Adenoma Associate 33423702
Arachnoid Cysts Associate 30855487
Atrial Fibrillation Associate 36226239
Autism Spectrum Disorder Associate 28720872
Breast Neoplasms Associate 30075825, 33492284, 37596527
Carcinoma Pancreatic Ductal Associate 26318045
Carcinoma Renal Cell Associate 39331921
Central Nervous System Vascular Malformations Associate 17209130, 21940735, 22105922, 22310223
Chromosome Duplication Associate 22105922